MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
Gene References into Functions
The expression of CysLTR1 and CysLTR2 is higher in the lymphocytes of hyperplasic tonsils in nonallergic childrenPMID:27221082
SE sensitization may be a risk factor for TH2 inflammation in nonatopic asthma and late-onset asthma and for pulmonary function decline in nonatopic asthma. In women with asthma, a CysLTR1 promoter polymorphism may be associated with SEB sensitization.PMID:28034578
In addition, TGF-beta1-induced expression of MMP-1 and MMP-3, generation of fibronectin and type I collagen production, focal adhesion kinase (FAK) and paxillin phosphorylation in HTFs were also ameliorated by montelukast in a dose dependent manner. These results suggested that montelukast might provide therapeutic possibilities for inhibition of scar formation after such surgery.PMID:28088523
CysLTRs -1 and -2 seem to be involved in lymphocyte maturation that occurs in tonsils, without influence of allergies.PMID:27115897
Data show that cysteinyl leukotriene receptor antagonists (LTRAs) users had a significantly lower cancer incidence rate than LTRA non-users did.PMID:27052782
in allergen-sensitized individuals, exposure to allergen can enhance T cell expression of CysLT1. This, in turn, would induce enhanced CD4+ T cell responsiveness to cysLTs, T cell activation, and Th2 polarization.PMID:25918735
CysLTR-1 and CysLTR-2 are highly expressed in the adenoid tissues from children with AH, suggesting that leukotrienes are involved in the pathogenesis of AH.PMID:25760841
The 5-LOX/LTC4 /CysLT1 signaling pathway regulates EGF-induced cell migration by increasing Tiam1 expression.PMID:24350867
Cysteinyl leukotrienes signaling downstream of CysLT1R in mast cells is differentially regulated by two distinct PKCalpha and PKC epsilon.PMID:23977066
CysLT(1) receptors in endothelial cells translocate to the nucleus in a ligand-independent manner after ischemic insult in vitro, and it is involved in the ischemic injury.PMID:23085741
A significant relationship was found between the expression of CysLT1 receptor and GR-beta in nasal polyps (R = .525, P = .04), whereas there was no significant relationship between the expression of CysLT1 receptor and GR-alpha in nasal polyps.PMID:23124618
Genetic variant may play a role in NSAID induced acute urticaria.PMID:23181793
A role of nuclear CysLT(1) receptor signaling in vascular smooth muscle cells inducing gene expression patterns associated with atherosclerosis.PMID:22527886
Bronchial mucosal CysLT1 receptor-positive inflammatory cells are present in the bronchial mucosa in COPD in greatest number in those experiencing a severe exacerbation.PMID:22871757
increased expression in tonsillar tissues of Chinese children with sleep-disordered breathingPMID:22634478
Data suggest that CysLT1 induces chemokine-like effects, supports accumulation and survival of chronic lymphocytic leukemia (CLL) cells in the bone marrow and thus represents a potential treatment target.PMID:21936770
cysteinyl-leukotriene receptors are differently expressed in fibroblast from peripheral versus central airways in asthmatics and healthy controls.PMID:21596548
upon ligand activation, CysLT(1)R is tyrosine-phosphorylated and released from heterodimers with CysLT(2)R and, subsequently, internalizes from the plasma membrane to the nuclear membrane in a clathrin-, arrestin-3-, and Rab-5-dependent mannerPMID:21203429
CysLT1-R expression following allergen provocation in asthma and allergic rhinitis.PMID:20462748
Data show functional expression of CysLT1 and 2 receptors on human platelets and demonstrate that CysLTs induced the release of significant amounts of RANTES, which suggests a novel role for human platelets in CysLT-mediated allergic inflammation.PMID:20433311
Genetic variants of CYSLTR1 promoter might be associated with gender specific expression of CysLT1 alternative transcripts in patients with asthma.PMID:20003473
interaction of CysLTs and CysLT(1) on eosinophils has the potential to play a prominent role in the pathophysiology of asthma.PMID:12373000
CysLT1R expression, up-regulated by IL-13 and leukotriene C4, may contribute to eotaxin production by lung fibroblasts.PMID:12682264
CysLT1 receptor upregulation by TGF-beta and IL-13 is associated with bronchial smooth muscle cell proliferation in response to LTD4.PMID:12743568
Arachidonic acid inhibits cysteinyl-leukotriene receptor activation in human pulmonary vesselsPMID:12751740
upregulated in colon cancer; affecting survivalPMID:12751768
the importance of increased CysLT signaling in airway smooth muscle functionPMID:15064240
CysLT1R as the first G protein-coupled receptor identified to date in which protein kinase C is the principal regulator of both rapid agonist-dependent internalization.PMID:15590629
CysLT 1 expression predominates on inflammatory leukocytes in aspirin-sensitive rhinosinusitis. Effects of cysteinyl leukotrienes on glands and epithelium may be mediated predominantly through cysLT 2. Potentially important therapeutic implications.PMID:15696087
There is increased nuclear localization of the CysLT(1) receptor in colorectal adenocarcinomas.PMID:15705869
upregulation of cysteinyl leukotriene-1 receptor is associated with asthmaPMID:16123393
Leukotriene D4, via the CysLT1 receptor, can transcriptionally activate IL-8 production, with involvement of the transcription factors p50, p65, Fos, and Jun.PMID:16809637
The 927T>C CYSLTR1 SNP was analyzed by direct sequencing after PCR amplification in childres with asthma and atopic dermatitis.PMID:16846449
In the group of male patients, the C allele of 927T> C CYSLTRI was more common among patients with asthma than controlsPMID:17153879
Desensitization of the CysLT1R is the principal mechanism by which PKC regulates the functional consequences of its desensitization in tracheea smooth muscle.PMID:17392478
analysis of polymorphism and differential regulation of CYSLTR1 transcription in human airway smooth muscle and monocytesPMID:17406065
Overexpression of cysteinyl LT1 receptor is associated with prostate cancerPMID:17549353
discovered a CysLT1 G300S variant that is carried with a significantly higher frequency in atopics and asthmatics from the Tristan da Cunha populationPMID:17558309
CysLTR1 polymorphism may contribute to development of the aspirin-intolerant asthma phenotype and can be used as a genetic marker for differentiating two major aspirin hypersensitivity phenotypes.PMID:17641958
CysLT2R signaling leads to terminal differentiation of colon carcinoma cells and growth inhibition, and its expression is relatively high in less malignant forms of colon cancer.PMID:17909024
CysLTR1 promoter polymorphism is a useful genetic marker for predicting leukotriene receptor antagonist requirement in aspirin intolerant asthma patienetsPMID:17924829
CysLT1R and CysLT2R expression in monocytes can be regulated by CysLT itself and T(H)2 cytokines at the transcriptional level.PMID:17941281
Our data show that CysLTs acting through CysLTR(1) can significantly influence the activation and migration of human monocytes.PMID:18028998
STAT-1 is involved in the signal transduction mechanism associated with cysteinyl leukotriene receptor 1 activation, supporting the hypothesis that it may represent a key transduction pathway leading to enhanced eosinophil adhesiveness.PMID:18305014
CysLT1 is involved in remodeling processes through modulation of furin transcription.PMID:18323532
Report the long-term effect of Helicobacter pylori eradication on COX-1/2, 5-LOX and leukotriene receptors in patients with a risk gastritis phenotype--a link to gastric carcinogenesis.PMID:18571838
Results demonstrate that cysteinyl leucotrienes cause contraction in the human and guinea-pig oesophagus, which is mediated by the cysteinyl leucotriene receptor type 1.PMID:18651869
SNP rs320995 in the cysteinyl leukotriene receptor 1 gene was associated with risk of asthmaPMID:18829683
The combined study of polymorphisms in genes of the leukotriene pathway could explain the differences observed in the studies reported on polymorphism -444A < C LTC4S individually analysed.PMID:19080797
The most potent CysLT(1) ligand, LTD(4), rapidly and significantly up-regulated alpha(4)beta(1) and alpha(5)beta(1) integrin-dependent adhesion of both primitive and committed hematopoietic progenitor cellsPMID:19454674
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon and heart.