Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1)

In Stock
Code: CSB-CF006465HU
Size:
20ug
20ug100ug
US$1620
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CYSLTR1 protein
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CYSLTR1
Uniprot NO.
Research Area
others
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-337aa
Target Protein Sequence
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
Gene References into Functions
  1. The expression of CysLTR1 and CysLTR2 is higher in the lymphocytes of hyperplasic tonsils in nonallergic children PMID:27221082
  2. SE sensitization may be a risk factor for TH2 inflammation in nonatopic asthma and late-onset asthma and for pulmonary function decline in nonatopic asthma. In women with asthma, a CysLTR1 promoter polymorphism may be associated with SEB sensitization. PMID:28034578
  3. In addition, TGF-beta1-induced expression of MMP-1 and MMP-3, generation of fibronectin and type I collagen production, focal adhesion kinase (FAK) and paxillin phosphorylation in HTFs were also ameliorated by montelukast in a dose dependent manner. These results suggested that montelukast might provide therapeutic possibilities for inhibition of scar formation after such surgery. PMID:28088523
  4. CysLTRs -1 and -2 seem to be involved in lymphocyte maturation that occurs in tonsils, without influence of allergies. PMID:27115897
  5. Data show that cysteinyl leukotriene receptor antagonists (LTRAs) users had a significantly lower cancer incidence rate than LTRA non-users did. PMID:27052782
  6. in allergen-sensitized individuals, exposure to allergen can enhance T cell expression of CysLT1. This, in turn, would induce enhanced CD4+ T cell responsiveness to cysLTs, T cell activation, and Th2 polarization. PMID:25918735
  7. CysLTR-1 and CysLTR-2 are highly expressed in the adenoid tissues from children with AH, suggesting that leukotrienes are involved in the pathogenesis of AH. PMID:25760841
  8. The 5-LOX/LTC4 /CysLT1 signaling pathway regulates EGF-induced cell migration by increasing Tiam1 expression. PMID:24350867
  9. Cysteinyl leukotrienes signaling downstream of CysLT1R in mast cells is differentially regulated by two distinct PKCalpha and PKC epsilon. PMID:23977066
  10. CysLT(1) receptors in endothelial cells translocate to the nucleus in a ligand-independent manner after ischemic insult in vitro, and it is involved in the ischemic injury. PMID:23085741
  11. A significant relationship was found between the expression of CysLT1 receptor and GR-beta in nasal polyps (R = .525, P = .04), whereas there was no significant relationship between the expression of CysLT1 receptor and GR-alpha in nasal polyps. PMID:23124618
  12. Genetic variant may play a role in NSAID induced acute urticaria. PMID:23181793
  13. A role of nuclear CysLT(1) receptor signaling in vascular smooth muscle cells inducing gene expression patterns associated with atherosclerosis. PMID:22527886
  14. Bronchial mucosal CysLT1 receptor-positive inflammatory cells are present in the bronchial mucosa in COPD in greatest number in those experiencing a severe exacerbation. PMID:22871757
  15. increased expression in tonsillar tissues of Chinese children with sleep-disordered breathing PMID:22634478
  16. Data suggest that CysLT1 induces chemokine-like effects, supports accumulation and survival of chronic lymphocytic leukemia (CLL) cells in the bone marrow and thus represents a potential treatment target. PMID:21936770
  17. cysteinyl-leukotriene receptors are differently expressed in fibroblast from peripheral versus central airways in asthmatics and healthy controls. PMID:21596548
  18. upon ligand activation, CysLT(1)R is tyrosine-phosphorylated and released from heterodimers with CysLT(2)R and, subsequently, internalizes from the plasma membrane to the nuclear membrane in a clathrin-, arrestin-3-, and Rab-5-dependent manner PMID:21203429
  19. CysLT1-R expression following allergen provocation in asthma and allergic rhinitis. PMID:20462748
  20. Data show functional expression of CysLT1 and 2 receptors on human platelets and demonstrate that CysLTs induced the release of significant amounts of RANTES, which suggests a novel role for human platelets in CysLT-mediated allergic inflammation. PMID:20433311
  21. Genetic variants of CYSLTR1 promoter might be associated with gender specific expression of CysLT1 alternative transcripts in patients with asthma. PMID:20003473
  22. interaction of CysLTs and CysLT(1) on eosinophils has the potential to play a prominent role in the pathophysiology of asthma. PMID:12373000
  23. CysLT1R expression, up-regulated by IL-13 and leukotriene C4, may contribute to eotaxin production by lung fibroblasts. PMID:12682264
  24. CysLT1 receptor upregulation by TGF-beta and IL-13 is associated with bronchial smooth muscle cell proliferation in response to LTD4. PMID:12743568
  25. Arachidonic acid inhibits cysteinyl-leukotriene receptor activation in human pulmonary vessels PMID:12751740
  26. upregulated in colon cancer; affecting survival PMID:12751768
  27. the importance of increased CysLT signaling in airway smooth muscle function PMID:15064240
  28. CysLT1R as the first G protein-coupled receptor identified to date in which protein kinase C is the principal regulator of both rapid agonist-dependent internalization. PMID:15590629
  29. CysLT 1 expression predominates on inflammatory leukocytes in aspirin-sensitive rhinosinusitis. Effects of cysteinyl leukotrienes on glands and epithelium may be mediated predominantly through cysLT 2. Potentially important therapeutic implications. PMID:15696087
  30. There is increased nuclear localization of the CysLT(1) receptor in colorectal adenocarcinomas. PMID:15705869
  31. upregulation of cysteinyl leukotriene-1 receptor is associated with asthma PMID:16123393
  32. Leukotriene D4, via the CysLT1 receptor, can transcriptionally activate IL-8 production, with involvement of the transcription factors p50, p65, Fos, and Jun. PMID:16809637
  33. The 927T>C CYSLTR1 SNP was analyzed by direct sequencing after PCR amplification in childres with asthma and atopic dermatitis. PMID:16846449
  34. In the group of male patients, the C allele of 927T> C CYSLTRI was more common among patients with asthma than controls PMID:17153879
  35. Desensitization of the CysLT1R is the principal mechanism by which PKC regulates the functional consequences of its desensitization in tracheea smooth muscle. PMID:17392478
  36. analysis of polymorphism and differential regulation of CYSLTR1 transcription in human airway smooth muscle and monocytes PMID:17406065
  37. Overexpression of cysteinyl LT1 receptor is associated with prostate cancer PMID:17549353
  38. discovered a CysLT1 G300S variant that is carried with a significantly higher frequency in atopics and asthmatics from the Tristan da Cunha population PMID:17558309
  39. CysLTR1 polymorphism may contribute to development of the aspirin-intolerant asthma phenotype and can be used as a genetic marker for differentiating two major aspirin hypersensitivity phenotypes. PMID:17641958
  40. CysLT2R signaling leads to terminal differentiation of colon carcinoma cells and growth inhibition, and its expression is relatively high in less malignant forms of colon cancer. PMID:17909024
  41. CysLTR1 promoter polymorphism is a useful genetic marker for predicting leukotriene receptor antagonist requirement in aspirin intolerant asthma patienets PMID:17924829
  42. CysLT1R and CysLT2R expression in monocytes can be regulated by CysLT itself and T(H)2 cytokines at the transcriptional level. PMID:17941281
  43. Our data show that CysLTs acting through CysLTR(1) can significantly influence the activation and migration of human monocytes. PMID:18028998
  44. STAT-1 is involved in the signal transduction mechanism associated with cysteinyl leukotriene receptor 1 activation, supporting the hypothesis that it may represent a key transduction pathway leading to enhanced eosinophil adhesiveness. PMID:18305014
  45. CysLT1 is involved in remodeling processes through modulation of furin transcription. PMID:18323532
  46. Report the long-term effect of Helicobacter pylori eradication on COX-1/2, 5-LOX and leukotriene receptors in patients with a risk gastritis phenotype--a link to gastric carcinogenesis. PMID:18571838
  47. Results demonstrate that cysteinyl leucotrienes cause contraction in the human and guinea-pig oesophagus, which is mediated by the cysteinyl leucotriene receptor type 1. PMID:18651869
  48. SNP rs320995 in the cysteinyl leukotriene receptor 1 gene was associated with risk of asthma PMID:18829683
  49. The combined study of polymorphisms in genes of the leukotriene pathway could explain the differences observed in the studies reported on polymorphism -444A < C LTC4S individually analysed. PMID:19080797
  50. The most potent CysLT(1) ligand, LTD(4), rapidly and significantly up-regulated alpha(4)beta(1) and alpha(5)beta(1) integrin-dependent adhesion of both primitive and committed hematopoietic progenitor cells PMID:19454674

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon and heart.
Database Links

HGNC: 17451

UNIGENE: Hs.733809

KEGG: hsa:10800

STRING: 9606.ENSP00000362401

OMIM: 300201

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products