AFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
Gene References into Functions
Ultraviolet- and infrared-induced 11 beta-hydroxysteroid dehydrogenase type 1 activating skin photoaging is inhibited by red ginseng extract containing high concentration of ginsenoside Rg3.PMID:28793178
The authors show that lipoproteins including brain (apoE) and circulating (high-density lipoprotein, HDL) synergize to facilitate beta-amyloid transport across bioengineered human cerebral vessels.PMID:28994390
results indicated that the HSD11B1 rs12086634 is associated with both type 2 diabetes (T2D) and metabolic syndrome (metS) but HSD11B1 rs846910 is associated with only T2D in South Indian populationPMID:28750217
The present study shows the temporal localisation of 11beta-HSD1 in uterus, highlighting its importance in the timing of gestation and suggesting its contribution in the myometrium contraction.PMID:28237720
Neuroticism was associated with the rs12565406 polymorphism and had a mediatory role in the association between the polymorphism and postpartum depression. This finding elucidates the genetic background of neuroticism and postpartum depression.PMID:27721188
This mini-review will focus on 11beta-HSD1 in skeletal muscle and its postulated link to obesity and insulin-resistance.PMID:28765040
This study investigated the contribution of first trimester decidua to glucocorticoid availability at the fetal-maternal interface by assessing the expression and regulation of 11beta-HSD in human first trimester decidual tissues.PMID:27544778
Moderate downregulation of 11beta-HSD1 can attenuate insulin insensitivity and the impairment of glucose-stimulated insulin secretion.PMID:29078846
distributed extensively on the maternal side including decidual stromal cells and epithelial cells but scarcely on the fetal side except for localization in the fetal blood vessels of the chorionic villiPMID:27697223
The reduction of DHT obese homozygotic twins could be linked to its increased degradation by AKR1C2 and HSD11B1, and increased estrogen levels could be linked to increased adiposity-related expression of aromatase in adipose tissue.PMID:28619249
this study shows that the phenotypic switch of adipose tissue macrophages from M2 to mixed M1/M2 phenotype occurred through differentiation of adipocytes in obese individuals, and upregulation of intracellular 11beta-HSD1 might play a role in the processPMID:27698011
11beta-HSD-2 plays an important role in the development of bone or osteoblast cell apoptosis, and the decreased expression of 11beta-HSD-2 may aggravate steroid induced bone/osteoblast cell apoptosis.PMID:28698139
11beta-HSD1 may be an important enzyme in the pathogenesis of fatty liver and visceral obesity.PMID:27715400
In HSD11B1 gene of rs3753519-stratified analysis, carriers of the minor allele presented significantly increased BMI, fasting plasma glucose and HOMA-IR. The study provides support for plausible implication of the HSD11B1 polymorphisms in susceptibility to develop undesirable effects of glucocorticoid replacement in Addison's disease.PMID:27083553
Increased 11beta-HSD1 expression and its reductase activity in granulosa cells are the major causes of increased cortisol concentration in the follicular fluid of PCOS with insulin resistance.PMID:26934392
Reciprocal regulation of the glucocorticoid metabolizing enzymes, 11beta-hydroxysteroid dehydrogenase types 1 and 2, is associated with steroid-responsiveness and disease remission in childhood nephrotic syndrome.PMID:27507896
increased cortisol and 11beta-HSD1 abundance and decreased LOX abundance were observed in human amnion tissue after the labor-initiated spontaneous rupture of membranesPMID:27533889
These findings indicated that 11beta-HSD1 inhibition can give a potential benefit in reducing obesity and lowering insulin resistance by modulating the insulin-signaling pathway and adipocytokine production.PMID:27268236
Review of the role of HSD11B1 in pregnancy complications, fetal diseases, and later life morbidity.PMID:27018008
the infiltration of macrophages in the form of crown-line structures in subcutaneous adipose tissue is associated with increased 11BHSD1 levels. It may be an important mechanism in the development of metabolic disorders.PMID:27219880
hyperactive hypothalamo-pituitary-adrenocortical axis in overweight diabetic subjects may be associated with downregulation of 11beta-HSD1, MR, and GR in the brain.PMID:26212138
ins4436A in the HSD11B1 gene is associated with essential hypertension in a Polish populationPMID:26671915
the availability of H6PDH determines the different direction of 11beta-HSD1 in liver and Leydig cells.PMID:26528718
we also found a significant difference between AA and AG genotype of rs6688832 and the AG genotype was associated with hyperandrogenism, but no statistical different distribution of polymorphism rs17368528 of H6PD and rs846908 of HSD11B1 were observedPMID:26452272
11beta-HSD1 expressed in polyp-derived epithelial cells may be involved in the anti-inflammatory function of glucocorticoid in the treatment of nasal polyps, which contributes to increased levels of endogenous cortisol.PMID:26163245
Our work is one of the first comprehensive views of DNA methylation and expression in the placenta for both HSD11B types 1 and 2, linking epigenetic alterations with the regulation of fetal stress and birth weight outcomes.PMID:25788665
Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11betaHSD1.PMID:25659145
Our results indicate that HSD11B1 polymorphisms may contribute toward the development of MetS in psychiatric patients treated with potential weight gain-inducing psychotropic drugs, but do not play a significant role in the general populationPMID:25751397
Glucocorticoids and 11beta-hydroxysteroid dehydrogenases: mechanisms for hypertensionPMID:25666420
This review describes the body of work performed over the past decade detailing the importance and regulation of HSD11B1 in humans, and its relevance to metabolic disease. [review]PMID:25436731
Promoter SNPs of the HSD11B1 gene might exert a potential genetic protective role against the development of PCOS, possibly via their beneficial effect on carbohydrate homeostasis due to facilitation of insulin efflux from pancreatic beta-cells.PMID:24969481
Skeletal muscle 11beta-HSD1 is up-regulated with age in women and is associated with reduced grip strength, insulin resistance, and an adverse body composition profile.PMID:25989394
The polymorphism of HSD11B1 may be a cause of childhood obesity, or even associated with the complication of childhood obesity.PMID:24729284
Although cerebral 11betaHSD1 reductase activity may be greater in cognitively impaired patients, in healthy men any contribution of 11betaHSD1 in the brain to systemic cortisol/cortisone turnover is negligible.PMID:25393644
placental gene expression of 11bHSD-1 may be indirectly connected with infantile growth via adiponectin-associated metabolic regulation represented by adiponectin levels in umbilical cord blood.PMID:24147632
These results indicate that chronic rhinosinusitis -relevant cytokines can modulate the expression of 11beta-HSD1, 11beta-HSD2, and CYP11B1 in the sinus mucosa, resulting in increasing intracellular concentrations of bioactive glucocorticoids.PMID:24810847
Polymorphisms in the 11betaHSD1 and NR3C1 genes were associated with impaired cognitive function in Cushings syndrome.PMID:24915124
Development of specific inhibitors targeting 11beta-HSD1 might be a promising way to improve impaired insulin-stimulated glucose uptake.PMID:24122936
In African Americans, but not Hispanics, subcutaneous adipose tissue 11betaHSD1 is associated with insulin sensitivity and disposition index, and might be mediated by hepatic fat fraction.PMID:23836520
Increased skeletal muscle 11betaHSD1 mRNA is associated with lower muscle strength in aging.PMID:24391882
The expression levels of 11beta-HSD1, CYP11B1, and cortisol were up-regulated in mild and moderate/severe persistent allergic nasal mucosa.PMID:24447082
Pro-inflammatory cytokine induction of 11beta-hydroxysteroid dehydrogenase type 1 in A549 cells requires phosphorylation of C/EBPbeta at Thr235.PMID:24086653
in a South Indian population, a polymorphism of the HSD11B1 gene containing the single-nucleotide polymorphism (SNP) rs12086634 T-->G may have a role in metabolic syndromePMID:23869418
Data suggest that HSD11B1 expression and activity in fetal membranes during prolonged pregnancy are similar in women who enter labor spontaneously or who respond to labor induction; HSD11B1 expression and activity are low in non-responders.PMID:24054540
The aim of the work was to investigate the expression of HSD11B1, HSD11B2, H6PDH, and glucocorticoids receptor (GR) mRNA in subcutaneous adipose tissue (SAT) from obese women with or without polycystic ovary syndrome.PMID:23979790
Data suggest that males exhibit higher HSD11B1 activity in cultured adipocytes than females; no such difference was observed in biopsy samples of subcutaneous adipose tissue; HSD11B1 expression correlates with insulin resistance and adiposity.PMID:23701286
A variant (rs932335) in the HSD11B1 gene is associated with colorectal cancer.PMID:24061267
Two critical enzymes 11beta-HSD1 and 11beta-HSD2 that regulate glucocorticoid activities are expressed inversely in malignant hepatocytes, resulting in the inactivation of endogenous glucocorticoids and the loss of gluconeogenesis.PMID:24149070
Genetic variations in HSD11B1 may affect the physiological cortisol levels and the severity of age-related osteoporosis.PMID:24285685
CBX treatment inhibited the stimulatory effects of BPA (at 10 nM) on PPAR-gamma and LPL mRNA expression, whereas RU486 inhibited 11beta-HSD1 mRNA expression in the adipocytes.PMID:23090578
Show
More
Hide
All
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Protein Families
Short-chain dehydrogenases/reductases (SDR) family