Recombinant Human 11-beta-hydroxysteroid dehydrogenase 1 (HSD11B1), partial

Code: CSB-EP010763HUd7
Size:
20ug
20ug100ug1mg
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human HSD11B1 protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HSD11B1
Uniprot NO.
Research Area
Cancer
Alternative Names
11-DH;11-beta-HSD1;7-oxosteroid reductase;Corticosteroid 11-beta-dehydrogenase isozyme 1;Short chain dehydrogenase/reductase family 26C member 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-292aa
Target Protein Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
Gene References into Functions
  1. Ultraviolet- and infrared-induced 11 beta-hydroxysteroid dehydrogenase type 1 activating skin photoaging is inhibited by red ginseng extract containing high concentration of ginsenoside Rg3. PMID:28793178
  2. The authors show that lipoproteins including brain (apoE) and circulating (high-density lipoprotein, HDL) synergize to facilitate beta-amyloid transport across bioengineered human cerebral vessels. PMID:28994390
  3. results indicated that the HSD11B1 rs12086634 is associated with both type 2 diabetes (T2D) and metabolic syndrome (metS) but HSD11B1 rs846910 is associated with only T2D in South Indian population PMID:28750217
  4. The present study shows the temporal localisation of 11beta-HSD1 in uterus, highlighting its importance in the timing of gestation and suggesting its contribution in the myometrium contraction. PMID:28237720
  5. Neuroticism was associated with the rs12565406 polymorphism and had a mediatory role in the association between the polymorphism and postpartum depression. This finding elucidates the genetic background of neuroticism and postpartum depression. PMID:27721188
  6. This mini-review will focus on 11beta-HSD1 in skeletal muscle and its postulated link to obesity and insulin-resistance. PMID:28765040
  7. This study investigated the contribution of first trimester decidua to glucocorticoid availability at the fetal-maternal interface by assessing the expression and regulation of 11beta-HSD in human first trimester decidual tissues. PMID:27544778
  8. Moderate downregulation of 11beta-HSD1 can attenuate insulin insensitivity and the impairment of glucose-stimulated insulin secretion. PMID:29078846
  9. distributed extensively on the maternal side including decidual stromal cells and epithelial cells but scarcely on the fetal side except for localization in the fetal blood vessels of the chorionic villi PMID:27697223
  10. The reduction of DHT obese homozygotic twins could be linked to its increased degradation by AKR1C2 and HSD11B1, and increased estrogen levels could be linked to increased adiposity-related expression of aromatase in adipose tissue. PMID:28619249
  11. this study shows that the phenotypic switch of adipose tissue macrophages from M2 to mixed M1/M2 phenotype occurred through differentiation of adipocytes in obese individuals, and upregulation of intracellular 11beta-HSD1 might play a role in the process PMID:27698011
  12. 11beta-HSD-2 plays an important role in the development of bone or osteoblast cell apoptosis, and the decreased expression of 11beta-HSD-2 may aggravate steroid induced bone/osteoblast cell apoptosis. PMID:28698139
  13. 11beta-HSD1 may be an important enzyme in the pathogenesis of fatty liver and visceral obesity. PMID:27715400
  14. In HSD11B1 gene of rs3753519-stratified analysis, carriers of the minor allele presented significantly increased BMI, fasting plasma glucose and HOMA-IR. The study provides support for plausible implication of the HSD11B1 polymorphisms in susceptibility to develop undesirable effects of glucocorticoid replacement in Addison's disease. PMID:27083553
  15. Increased 11beta-HSD1 expression and its reductase activity in granulosa cells are the major causes of increased cortisol concentration in the follicular fluid of PCOS with insulin resistance. PMID:26934392
  16. Reciprocal regulation of the glucocorticoid metabolizing enzymes, 11beta-hydroxysteroid dehydrogenase types 1 and 2, is associated with steroid-responsiveness and disease remission in childhood nephrotic syndrome. PMID:27507896
  17. increased cortisol and 11beta-HSD1 abundance and decreased LOX abundance were observed in human amnion tissue after the labor-initiated spontaneous rupture of membranes PMID:27533889
  18. These findings indicated that 11beta-HSD1 inhibition can give a potential benefit in reducing obesity and lowering insulin resistance by modulating the insulin-signaling pathway and adipocytokine production. PMID:27268236
  19. Review of the role of HSD11B1 in pregnancy complications, fetal diseases, and later life morbidity. PMID:27018008
  20. the infiltration of macrophages in the form of crown-line structures in subcutaneous adipose tissue is associated with increased 11BHSD1 levels. It may be an important mechanism in the development of metabolic disorders. PMID:27219880
  21. hyperactive hypothalamo-pituitary-adrenocortical axis in overweight diabetic subjects may be associated with downregulation of 11beta-HSD1, MR, and GR in the brain. PMID:26212138
  22. ins4436A in the HSD11B1 gene is associated with essential hypertension in a Polish population PMID:26671915
  23. the availability of H6PDH determines the different direction of 11beta-HSD1 in liver and Leydig cells. PMID:26528718
  24. we also found a significant difference between AA and AG genotype of rs6688832 and the AG genotype was associated with hyperandrogenism, but no statistical different distribution of polymorphism rs17368528 of H6PD and rs846908 of HSD11B1 were observed PMID:26452272
  25. 11beta-HSD1 expressed in polyp-derived epithelial cells may be involved in the anti-inflammatory function of glucocorticoid in the treatment of nasal polyps, which contributes to increased levels of endogenous cortisol. PMID:26163245
  26. Our work is one of the first comprehensive views of DNA methylation and expression in the placenta for both HSD11B types 1 and 2, linking epigenetic alterations with the regulation of fetal stress and birth weight outcomes. PMID:25788665
  27. Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11betaHSD1. PMID:25659145
  28. Our results indicate that HSD11B1 polymorphisms may contribute toward the development of MetS in psychiatric patients treated with potential weight gain-inducing psychotropic drugs, but do not play a significant role in the general population PMID:25751397
  29. Glucocorticoids and 11beta-hydroxysteroid dehydrogenases: mechanisms for hypertension PMID:25666420
  30. This review describes the body of work performed over the past decade detailing the importance and regulation of HSD11B1 in humans, and its relevance to metabolic disease. [review] PMID:25436731
  31. Promoter SNPs of the HSD11B1 gene might exert a potential genetic protective role against the development of PCOS, possibly via their beneficial effect on carbohydrate homeostasis due to facilitation of insulin efflux from pancreatic beta-cells. PMID:24969481
  32. Skeletal muscle 11beta-HSD1 is up-regulated with age in women and is associated with reduced grip strength, insulin resistance, and an adverse body composition profile. PMID:25989394
  33. The polymorphism of HSD11B1 may be a cause of childhood obesity, or even associated with the complication of childhood obesity. PMID:24729284
  34. Although cerebral 11betaHSD1 reductase activity may be greater in cognitively impaired patients, in healthy men any contribution of 11betaHSD1 in the brain to systemic cortisol/cortisone turnover is negligible. PMID:25393644
  35. placental gene expression of 11bHSD-1 may be indirectly connected with infantile growth via adiponectin-associated metabolic regulation represented by adiponectin levels in umbilical cord blood. PMID:24147632
  36. These results indicate that chronic rhinosinusitis -relevant cytokines can modulate the expression of 11beta-HSD1, 11beta-HSD2, and CYP11B1 in the sinus mucosa, resulting in increasing intracellular concentrations of bioactive glucocorticoids. PMID:24810847
  37. Polymorphisms in the 11betaHSD1 and NR3C1 genes were associated with impaired cognitive function in Cushings syndrome. PMID:24915124
  38. Development of specific inhibitors targeting 11beta-HSD1 might be a promising way to improve impaired insulin-stimulated glucose uptake. PMID:24122936
  39. In African Americans, but not Hispanics, subcutaneous adipose tissue 11betaHSD1 is associated with insulin sensitivity and disposition index, and might be mediated by hepatic fat fraction. PMID:23836520
  40. Increased skeletal muscle 11betaHSD1 mRNA is associated with lower muscle strength in aging. PMID:24391882
  41. The expression levels of 11beta-HSD1, CYP11B1, and cortisol were up-regulated in mild and moderate/severe persistent allergic nasal mucosa. PMID:24447082
  42. Pro-inflammatory cytokine induction of 11beta-hydroxysteroid dehydrogenase type 1 in A549 cells requires phosphorylation of C/EBPbeta at Thr235. PMID:24086653
  43. in a South Indian population, a polymorphism of the HSD11B1 gene containing the single-nucleotide polymorphism (SNP) rs12086634 T-->G may have a role in metabolic syndrome PMID:23869418
  44. Data suggest that HSD11B1 expression and activity in fetal membranes during prolonged pregnancy are similar in women who enter labor spontaneously or who respond to labor induction; HSD11B1 expression and activity are low in non-responders. PMID:24054540
  45. The aim of the work was to investigate the expression of HSD11B1, HSD11B2, H6PDH, and glucocorticoids receptor (GR) mRNA in subcutaneous adipose tissue (SAT) from obese women with or without polycystic ovary syndrome. PMID:23979790
  46. Data suggest that males exhibit higher HSD11B1 activity in cultured adipocytes than females; no such difference was observed in biopsy samples of subcutaneous adipose tissue; HSD11B1 expression correlates with insulin resistance and adiposity. PMID:23701286
  47. A variant (rs932335) in the HSD11B1 gene is associated with colorectal cancer. PMID:24061267
  48. Two critical enzymes 11beta-HSD1 and 11beta-HSD2 that regulate glucocorticoid activities are expressed inversely in malignant hepatocytes, resulting in the inactivation of endogenous glucocorticoids and the loss of gluconeogenesis. PMID:24149070
  49. Genetic variations in HSD11B1 may affect the physiological cortisol levels and the severity of age-related osteoporosis. PMID:24285685
  50. CBX treatment inhibited the stimulatory effects of BPA (at 10 nM) on PPAR-gamma and LPL mRNA expression, whereas RU486 inhibited 11beta-HSD1 mRNA expression in the adipocytes. PMID:23090578

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity
Widely expressed. Highest expression in liver.
Database Links

HGNC: 5208

UNIGENE: Hs.195040

KEGG: hsa:3290

STRING: 9606.ENSP00000261465

OMIM: 600713

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products