MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA LLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Plays a major role in tight junction-specific obliteration of the intercellular space.
Gene References into Functions
this paper shows that TGF-beta1 alters esophageal epithelial barrier function by attenuation of claudin-7 in eosinophilic esophagitisPMID:28832026
In addition to replicating a previously identified genome-wide significant locus for corneal astigmatism near the PDGFRA gene, gene-based analysis identified three novel candidate genes, CLDN7, ACP2, and TNFAIP8L3, that warrant further investigation to understand their role in the pathogenesis of corneal astigmatism. (Meta-analysis)PMID:29422769
the present study revealed the distinct expression profiles of claudin5, 7 and 8 in nonneoplastic mucosal tissues and gastric carcinoma tissues. Furthermore, the expression of these claudin proteins was highly associated with metastatic progression and prognosis in patients with gastric carcinomaPMID:29901188
DICFM approach may be applied as an appropriate approach to quantify the immunohistochemical staining of claudin-7 on the cell membrane and claudin-7 may serve as a marker for identification of lung cancerPMID:29512497
Cycling hypoxia could induce significant changes in CLDN1 and CLDN7 expression in nasopharyngeal cancer cells, indirectly regulation P18 expression and affecting cell invasion/proliferation.PMID:28055967
These results identify EpCAM as a substrate of matriptase and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that causes disease when it is dysregulated.PMID:28094766
84/118, 64/118, 52/118 reaction with claudin-1, claudin-3 and claudin-4 in cancer and colon polyps had a membrane localization, respectively.Mislocalization claudin-3 to nucleus in colon cancer and mislocalization claudin-4 to nucleus in adenomas of the colon were detected for the first time.PMID:28295005
suggest that the reduction of CLDN5, 7, and 18 expression loses the suppressive ability of interaction between PDK1 and Akt and causes sustained phosphorylation of Akt, resulting in the disordered proliferation in lung squamous carcinoma cellsPMID:27884700
that the dysregulated expression of these miRNAs, in conjunction with the high claudin 1 levels, could serve as a useful biomarker that identifies a subset of tumors within the poorly characterized basal-like subtype of breast cancerPMID:26982264
The expression of claudin-7 has no obviously difference between cervical carcinoma tissues and adjacent non-neoplastic tissues.PMID:26464708
We identified hepatocyte nuclear factor 4alpha as a regulatory factor that bound endogenous CLDN7 promoter in differentiating intestinal epithelial cells and stimulated CLDN7 promoter activity.PMID:26216285
we identified a previously unrecognized function of claudin-7 in regulating cell proliferation and maintaining epithelial cell attachment through engaging integrin beta1.PMID:26081244
A variant, rs222857, in the CLDN7 locus, predicted adiponectin increases within intensive lifestyle intervention.PMID:25759378
CLDN-7 palmitoylation prohibits tight junction integration and fosters glycolipid-enriched membrane domains recruitment. Via associated molecules, palmitoylated CLDN-7supports motility and invasion.PMID:26054340
The increased claudin-1 expression was significantly associated with the high pathologic grade, the presence of microscopic perineural invasion, vascular invasion, nodal metastasis, and advanced clinical stage of oral squamous cell carcinoma.PMID:25078758
Data indicate that claudin-7 knockdown cells display decreased anchorage-independent growth.PMID:25514462
Loss of claudin-7 potentiates epithelial-to-mesenchymal transition to promote colon cancer, in a manner dependent on Rab25.PMID:25500541
Icreased claudin 7 expression was related to decreased survival in nasopharyngeal carcinoma.PMID:25778318
Increased expression of claudin-7 is associated with liver cirrhosis and hepatocellular carcinoma.PMID:24696415
This study suggests the possibility that EpCAM, together with CD44v6 and claudin-7 as well as ALDH1, may be involved in the development of the aggressive phenotype of anaplastic thyroid carcinoma.PMID:24727741
these results confirm the role of claudin-1 as a promoter of colon tumorigenesis and further identify the role of the dysregulated antigen-tumor interaction and inflammation in claudin-1-dependent upregulation of colon tumorigenesis.PMID:24997475
Evaluated expression of claudins in gastric cancer and determined their significance for patient outcome. Claudin-3 and claudin-7 were expressed in 25.4% and 29.9% of gastric cancer tissues; 51.5% of gastric cancer tissues had reduced claudin-18.PMID:24333468
These results suggest aberrant Claudin 7, alpha - and beta-catenin expression and/or localisation patterns may be putative markers for distinguishing localised prostate cancer from aggressive metastatic disease when used collectively.PMID:24358122
the CLDN7 rs4562 (c.590C>T) genotype had a higher risk of lymph node involvement and a lower degree of tumor differentiationPMID:24479816
lack of claudin-7 expression in the tumour centre may be used to identify patients with increased risk for regional recurrencePMID:23953778
Claudin-7 was phosphorylated at serine 204 by protein kinase C.PMID:23433123
Survival analysis showed a trend toward a better prognosis among patients with overexpression of claudin-7 in hepatocellular carcinoma.PMID:23146509
Increased expression of claudin-1 contributes to an anti-apoptotic role in TNF-alpha-induced apoptosis.PMID:22941467
CD24+ (P=0.07) and claudin-7 positivity (P=0.05) were associated with reduced time of recurrence, suggesting a contribution of these markers to aggressiveness of breast cancer.PMID:21956537
Claudin-7 and tricellulin were markedly reduced at all stages of tumor development. In situ hybridization analysis showed no correlation between HPV infection and altered expression of the tight junction proteins.PMID:21480761
Claudin-7 is significantly upregulated in epithelial ovarian cancer.PMID:21789222
down-regulation of Claudin-7 and overexpression of Slug in lung squamous cell carcinoma and adenocarcinomaPMID:21645451
The claudin-7 inhibits cell migration and invasion through ERK/MAPK signaling pathway in response to growth factor stimulation in human lung cancer cells.PMID:21641901
transcriptional activity of claudin 7 gene not a useful marker of laryngeal tumorPMID:21193919
Claudin-7 mRNA level is decreased already as an early event in colorectal carcinogenesis, probably contributing to the compromised epithelial barrier in adenomas.PMID:21310043
Claudin-7 down-regulation is an important feature in oral squamous cell carcinomaPMID:21083599
These data suggest that proteasomes regulate claudin-1 localization at the plasma membrane, which changes upon proteasomal inhibition to a Rab5a-mediated endosomal localization.PMID:20926780
Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line.PMID:20874001
Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis.PMID:19960275
Claudin-1 was expressed in all 18 cases of Epstein-Barr virus-associated nasopharyngeal carcinoma studiedPMID:20204275
Loss of claudin-7 correlates with histological grade in both ductal carcinoma in situ and invasive ductal carcinoma of the breast, providing insight into the potential role of CLDN-7 in the progression and ability of breast cancer cells to disseminate.PMID:12673207
2 forms of claudin-7, a full-length form with 211 AA residues and a C-terminal truncated form with 158 AA residues, are able to regulate the expression of a tissue-specific protein, prostate-specific antigen, in the LNCaP prostate cancer cell line.PMID:14502431
Loss of claudin-1 expression proved to be a strong predictor of disease recurrence and poor patient survival in stage II colon cancer.PMID:15475928
Claudin-1 and claudin-7 may play a significant role in tumor progression of cervical neoplasia and may represent useful markers for malignant transformation of cervical squamous cells.PMID:15790437
Overexpression of claudin-7 is associated with gastric tumorigenesisPMID:16049341
induction of claudin7 expression by ELF3 appears critical to the formation of the epithelial structures in biphasic synovial sarcomaPMID:17060315
When compared, adenocarcinomas and squamous cell carcinomas revealed significant differences in CLDN7 expression.PMID:17418912
claudin-7-associated EpCAM is recruited into (tetraspanin-enriched membrane microdomains) and forms a complex with CO-029 and CD44v6 that facilitates metastasis formationPMID:17579117
Results show show that claudin 7 expression changed with the gastric carcinogenic process and that this is implicated in cancer characteristics.PMID:17611659
Claudin-7 to be a candidate expression marker for distinguishing chromophobe renal cell carcinoma from other renal tumor subtypes, including the morphologically similar oncocytoma.PMID:17922590
Expressed in kidney, lung and prostate. Isoform 1 seems to be predominant, except in some normal prostate samples, where isoform 2 is the major form. Down-regulated in breast cancers, including ductal carcinoma in situ (DCIS), lobular carcinoma in situ (L