Recombinant Human Claudin-7 (CLDN7)-VLPs

Code: CSB-MP005509HU
Size:
20ug
20ug100ug1mg
US$620
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CLDN7 protein-VLPs
Purity
VLPs
Target Names
CLDN7
Uniprot NO.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-211aa
Target Protein Sequence
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • CSB-MP005509HU is detected by Mouse anti-6*His monoclonal antibody.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Plays a major role in tight junction-specific obliteration of the intercellular space.
Gene References into Functions
  1. this paper shows that TGF-beta1 alters esophageal epithelial barrier function by attenuation of claudin-7 in eosinophilic esophagitis PMID:28832026
  2. In addition to replicating a previously identified genome-wide significant locus for corneal astigmatism near the PDGFRA gene, gene-based analysis identified three novel candidate genes, CLDN7, ACP2, and TNFAIP8L3, that warrant further investigation to understand their role in the pathogenesis of corneal astigmatism. (Meta-analysis) PMID:29422769
  3. the present study revealed the distinct expression profiles of claudin5, 7 and 8 in nonneoplastic mucosal tissues and gastric carcinoma tissues. Furthermore, the expression of these claudin proteins was highly associated with metastatic progression and prognosis in patients with gastric carcinoma PMID:29901188
  4. DICFM approach may be applied as an appropriate approach to quantify the immunohistochemical staining of claudin-7 on the cell membrane and claudin-7 may serve as a marker for identification of lung cancer PMID:29512497
  5. Cycling hypoxia could induce significant changes in CLDN1 and CLDN7 expression in nasopharyngeal cancer cells, indirectly regulation P18 expression and affecting cell invasion/proliferation. PMID:28055967
  6. These results identify EpCAM as a substrate of matriptase and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that causes disease when it is dysregulated. PMID:28094766
  7. 84/118, 64/118, 52/118 reaction with claudin-1, claudin-3 and claudin-4 in cancer and colon polyps had a membrane localization, respectively.Mislocalization claudin-3 to nucleus in colon cancer and mislocalization claudin-4 to nucleus in adenomas of the colon were detected for the first time. PMID:28295005
  8. suggest that the reduction of CLDN5, 7, and 18 expression loses the suppressive ability of interaction between PDK1 and Akt and causes sustained phosphorylation of Akt, resulting in the disordered proliferation in lung squamous carcinoma cells PMID:27884700
  9. that the dysregulated expression of these miRNAs, in conjunction with the high claudin 1 levels, could serve as a useful biomarker that identifies a subset of tumors within the poorly characterized basal-like subtype of breast cancer PMID:26982264
  10. The expression of claudin-7 has no obviously difference between cervical carcinoma tissues and adjacent non-neoplastic tissues. PMID:26464708
  11. We identified hepatocyte nuclear factor 4alpha as a regulatory factor that bound endogenous CLDN7 promoter in differentiating intestinal epithelial cells and stimulated CLDN7 promoter activity. PMID:26216285
  12. we identified a previously unrecognized function of claudin-7 in regulating cell proliferation and maintaining epithelial cell attachment through engaging integrin beta1. PMID:26081244
  13. A variant, rs222857, in the CLDN7 locus, predicted adiponectin increases within intensive lifestyle intervention. PMID:25759378
  14. CLDN-7 palmitoylation prohibits tight junction integration and fosters glycolipid-enriched membrane domains recruitment. Via associated molecules, palmitoylated CLDN-7supports motility and invasion. PMID:26054340
  15. The increased claudin-1 expression was significantly associated with the high pathologic grade, the presence of microscopic perineural invasion, vascular invasion, nodal metastasis, and advanced clinical stage of oral squamous cell carcinoma. PMID:25078758
  16. Data indicate that claudin-7 knockdown cells display decreased anchorage-independent growth. PMID:25514462
  17. Loss of claudin-7 potentiates epithelial-to-mesenchymal transition to promote colon cancer, in a manner dependent on Rab25. PMID:25500541
  18. Icreased claudin 7 expression was related to decreased survival in nasopharyngeal carcinoma. PMID:25778318
  19. Increased expression of claudin-7 is associated with liver cirrhosis and hepatocellular carcinoma. PMID:24696415
  20. This study suggests the possibility that EpCAM, together with CD44v6 and claudin-7 as well as ALDH1, may be involved in the development of the aggressive phenotype of anaplastic thyroid carcinoma. PMID:24727741
  21. these results confirm the role of claudin-1 as a promoter of colon tumorigenesis and further identify the role of the dysregulated antigen-tumor interaction and inflammation in claudin-1-dependent upregulation of colon tumorigenesis. PMID:24997475
  22. Evaluated expression of claudins in gastric cancer and determined their significance for patient outcome. Claudin-3 and claudin-7 were expressed in 25.4% and 29.9% of gastric cancer tissues; 51.5% of gastric cancer tissues had reduced claudin-18. PMID:24333468
  23. These results suggest aberrant Claudin 7, alpha - and beta-catenin expression and/or localisation patterns may be putative markers for distinguishing localised prostate cancer from aggressive metastatic disease when used collectively. PMID:24358122
  24. the CLDN7 rs4562 (c.590C>T) genotype had a higher risk of lymph node involvement and a lower degree of tumor differentiation PMID:24479816
  25. lack of claudin-7 expression in the tumour centre may be used to identify patients with increased risk for regional recurrence PMID:23953778
  26. Claudin-7 was phosphorylated at serine 204 by protein kinase C. PMID:23433123
  27. Survival analysis showed a trend toward a better prognosis among patients with overexpression of claudin-7 in hepatocellular carcinoma. PMID:23146509
  28. Increased expression of claudin-1 contributes to an anti-apoptotic role in TNF-alpha-induced apoptosis. PMID:22941467
  29. CD24+ (P=0.07) and claudin-7 positivity (P=0.05) were associated with reduced time of recurrence, suggesting a contribution of these markers to aggressiveness of breast cancer. PMID:21956537
  30. Claudin-7 and tricellulin were markedly reduced at all stages of tumor development. In situ hybridization analysis showed no correlation between HPV infection and altered expression of the tight junction proteins. PMID:21480761
  31. Claudin-7 is significantly upregulated in epithelial ovarian cancer. PMID:21789222
  32. down-regulation of Claudin-7 and overexpression of Slug in lung squamous cell carcinoma and adenocarcinoma PMID:21645451
  33. The claudin-7 inhibits cell migration and invasion through ERK/MAPK signaling pathway in response to growth factor stimulation in human lung cancer cells. PMID:21641901
  34. transcriptional activity of claudin 7 gene not a useful marker of laryngeal tumor PMID:21193919
  35. Claudin-7 mRNA level is decreased already as an early event in colorectal carcinogenesis, probably contributing to the compromised epithelial barrier in adenomas. PMID:21310043
  36. Claudin-7 down-regulation is an important feature in oral squamous cell carcinoma PMID:21083599
  37. These data suggest that proteasomes regulate claudin-1 localization at the plasma membrane, which changes upon proteasomal inhibition to a Rab5a-mediated endosomal localization. PMID:20926780
  38. Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line. PMID:20874001
  39. Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis. PMID:19960275
  40. Claudin-1 was expressed in all 18 cases of Epstein-Barr virus-associated nasopharyngeal carcinoma studied PMID:20204275
  41. Loss of claudin-7 correlates with histological grade in both ductal carcinoma in situ and invasive ductal carcinoma of the breast, providing insight into the potential role of CLDN-7 in the progression and ability of breast cancer cells to disseminate. PMID:12673207
  42. 2 forms of claudin-7, a full-length form with 211 AA residues and a C-terminal truncated form with 158 AA residues, are able to regulate the expression of a tissue-specific protein, prostate-specific antigen, in the LNCaP prostate cancer cell line. PMID:14502431
  43. Loss of claudin-1 expression proved to be a strong predictor of disease recurrence and poor patient survival in stage II colon cancer. PMID:15475928
  44. Claudin-1 and claudin-7 may play a significant role in tumor progression of cervical neoplasia and may represent useful markers for malignant transformation of cervical squamous cells. PMID:15790437
  45. Overexpression of claudin-7 is associated with gastric tumorigenesis PMID:16049341
  46. induction of claudin7 expression by ELF3 appears critical to the formation of the epithelial structures in biphasic synovial sarcoma PMID:17060315
  47. When compared, adenocarcinomas and squamous cell carcinomas revealed significant differences in CLDN7 expression. PMID:17418912
  48. claudin-7-associated EpCAM is recruited into (tetraspanin-enriched membrane microdomains) and forms a complex with CO-029 and CD44v6 that facilitates metastasis formation PMID:17579117
  49. Results show show that claudin 7 expression changed with the gastric carcinogenic process and that this is implicated in cancer characteristics. PMID:17611659
  50. Claudin-7 to be a candidate expression marker for distinguishing chromophobe renal cell carcinoma from other renal tumor subtypes, including the morphologically similar oncocytoma. PMID:17922590

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane. Cell junction, tight junction.
Protein Families
Claudin family
Tissue Specificity
Expressed in kidney, lung and prostate. Isoform 1 seems to be predominant, except in some normal prostate samples, where isoform 2 is the major form. Down-regulated in breast cancers, including ductal carcinoma in situ (DCIS), lobular carcinoma in situ (L
Database Links

HGNC: 2049

UNIGENE: Hs.513915

KEGG: hsa:1366

STRING: 9606.ENSP00000353475

OMIM: 609131

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products