MWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
65.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Plays a major role in tight junction-specific obliteration of the intercellular space.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Gene References into Functions
Antibodies recognizing native CLDN6 as displayed on cell surfaces and mediating complement-dependent cytotoxicity were elicited in vaccinated animals. The data suggest applications of CLDN6 displaying Virus-like particles in cancer immunotherapy.PMID:29131519
these results suggest that Helicobacter pylori lipopolysaccharide induces TLR2 expression in the gastric adenocarcinoma cells, and that the longer the exposure to lipopolysaccharide, the greater the expression of TLR2 in the cell membrane; consequently the expression of claudin-4, -6, -7 and -9 also increasesPMID:29031421
Study provides evidence that high expression of CLDN6 confers chemoresistance on breast cancer which is mediated by GSTP1, the activity of which is regulated by p53.PMID:29116019
CLDN6 enhances the chemoresistance to ADM via activating the AF-6/ERK signaling pathway and up-regulating cancer stem cell characters in MDAMB231 cells.PMID:29159771
we demonstrated that the downregulation of CLDN6 is regulated through promoter methylation by DNMT1, which depends on the SMAD2 pathway, and that CLDN6 is a key regulator in the SMAD2/DNMT1/CLDN6 pathway to inhibit EMT, migration and invasion of breast cancer cellsPMID:28867761
In conclusion, this information from bioinformatics analysis will help future attempts to better understand CLDN6 regulation and functions.PMID:28656265
high expression of CLDN 6 was observed in approx. 65% of the myxofibrosarcomas, whereas the benign soft tissue tumors did not show a high expression of CLDN 6. The expression of CLDN 6 in the myxofibrosarcomas was significantly higher than those of other tumor specimens. Among the myxofibrosarcomas, the high expression of CLDN 6 was correlated with high FNCLCC grades and high AJCC stages.PMID:28476380
Results show that DNA methylation down-regulates CLDN6 expression through MeCP2 binding to the CLDN6 promoter, deacetylating H3 and H4, and altering chromatin structure, consequently promoting migratory and invasive phenotype in breast cancer cells.PMID:27461117
Cldn6 was decreased in alveolar type II-like epithelial cells (A549) and primary small airway epithelial cells when exposed to cigarette smoke extPMID:27982694
suggest that claudin-6 induces MMP-2 activation through claudin-1 membrane expressionPMID:27914788
Data show that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not affect HCV pseudoparticles (HCVpp) entry.PMID:26561856
The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues.PMID:26191261
High levels of CLDN6 are associated with non-small-cell lung cancer.PMID:24710653
The expression of claudin-6 was down regulated in gastric cancer tissue.PMID:23919729
Only some hepatitis C virus strains efficiently use CLDN6 for infection.PMID:23775920
This work provides a proof of concept for the use of Claudin-6 to eliminate residual undifferentiated human pluripotent stem cells from culture.PMID:23778593
Although claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not dependent on claudin-6 and claudin-9.PMID:23864633
ASK1 signal may play a positive role in the inhibitory effect of claudin-6 in breast cancer.PMID:22925655
Our results show that claudin-6 protein is significantly down-regulated in breast invasive ductal carcinomasPMID:22455563
CLDN6 is not a specific biomarker for atypical teratoid rhabdoid tumors as it is expressed in a variety of other pediatric CNS and soft tissue tumors.PMID:21989342
17beta-E2 might regulate the expression of claudin-6 and inhibit the proliferation and migration of MCF-7 cells.PMID:20388399
Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line.PMID:20874001
CLDN6 may be a useful positive marker to help further identify atypical teratoid/rhabdoid tumors for diagnostic and treatment purposesPMID:19220299
Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesisPMID:19960275
The up-regulation of claudin-6 expression in MCF-7 breast cancer cells suppresses their malignant phenotypes with a correlation with the restoration of tight junction integrity.PMID:20367941
claudin-6, downregulates the malignant phenotype of breast carcinoma.PMID:20215972
Claudin 6 was not found in epithelioid glioblastomas or rhabdoid glioblastomas.PMID:20118769
CLDN6 and CLDN9, but not CLDN1, are expressed in peripheral blood mononuclear cells, an additional site of HCV replication.PMID:17804490
claudin-6 and claudin-9 expressed in CD81+ cells also enable the entry of HCV pseudoparticles derived from six of the major genotypes.PMID:18234789
CLDN6, clustered with CLDN9 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.PMID:12736707