Abbreviation
Recombinant Human CLDN6 protein, partial-VLPs
Purity
Greater than 95% as determined by SEC-HPLC.
Research Area
Microbiology
Species
Homo sapiens (Human)
Expression Region
138-181aa
Target Protein Sequence
WTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Human Claudin-6 (CLDN6) is a specialized antigen produced using Virus-Like Particle (VLP) technology, offering distinct advantages for immunology and microbiology research. The product is a C-terminal 10xHis-tagged partial protein corresponding to amino acids 138-181 of human CLDN6 and is expressed in a mammalian cell system. The core advantage of the VLP platform is its ability to display the target peptide sequence in a highly ordered, multimeric structure. This repetitive, particulate presentation mimics the natural surface of a virus, which typically results in significantly enhanced immunogenicity compared to monomeric proteins, making it a superior immunogen for antibody generation or vaccine development. Quality control underscores its reliability: purity exceeds 95% as determined by SEC-HPLC, and identity is confirmed by Western Blot using an anti-6*His antibody, showing a specific band at approximately 70 kDa—consistent with the expected molecular weight of the VLP-formed multimeric complex (62.5 kDa). This recombinant CLDN6 protein provides researchers with a potent, highly pure, and structurally advanced tool for targeting the CLDN6 extracellular domain.
