MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
The CXCR2 rs1126579 TT genotype had a significantly increased possibility of HCV spontaneous clearance.PMID:29948377
CXCR2 protein expression was up-regulated in both the epileptic foci of temporal lobe epilepsy patients and in the pilocarpine mouse model. The CXCR2 selective antagonist SB225002, which was i.p. administered during the spontaneous recurrent seizures (SRSs) latency window preceding SRS onset, suppressed SRSs activity during the chronic period of epilepsy.PMID:28705496
results indicated that the CXCR2 +1208 CT genotype is less frequent in advanced stages of prostate cancer, suggesting that this chemokine receptor plays a role in the pathogenesis of this diseasePMID:28668699
CXCR2 expression is a promoter of CRC local as well as distant metastasis and unfavorably associated with CRC patients' prognosis. Moreover, CXCR2 can stratify high-risk patients especially in normally early stage low-risk CRC patients.PMID:28415702
PADI4 contributes to gastric tumorigenesis by upregulating CXCR2, KRT14 and TNF-alpha expression.PMID:27556695
KHSV miR-K3 activates the GRK2/CXCR2/AKT axis inducing KSHV-induced angiogenesis and promoting KSHV latency.PMID:27058419
CXCR2 mRNA and protein expression levels were significantly decreased in preeclamptic placentas than normal control. The invasive abilities of the two trophoblast cell lines were significantly inhibited when CXCR2 was silenced, but that CXCR2 overexpression promoted trophoblast cells invasion.PMID:27324095
CXCR2 promotes breast cancer metastasis and chemoresistance via suppressing AKT1 and activating COX2.PMID:28964785
we conclude that CXCR2 is required for the recruitment of TANs, which in turn can suppress antitumor T-cell responses. We showed that CXCR2 ligands, particularly CXCL5, are elevated in both human and mouse PDA.PMID:27737879
this study shows that neutrophil expression levels of CVCR2 are decreased in septic patientsPMID:27016001
CXCR4 and CXCR2 were highly expressed in a high invasive gastric cancer cell model and in gastric cancer tissues; crosstalk between CXCR4 and CXCR2 contributed to EMT, migration and invasion of gastric cancer.PMID:28481874
A unique viral protein, vCXCL1, which targets three chemokine receptors: CXCR1 and CXCR2 expressed on neutrophils and CXCR1 and CX3CR1 expressed on Natural killer cells.PMID:27160907
The expressions of CXCL1 in cancer cells and CXCR2 in stromal cells are useful prognostic factors for gastric cancer patientsPMID:28575019
CXCR2 preferentially supports the maintenance of human pluripotent stem cell characteristics as well as facilitates ectodermal differentiation after the commitment to differentiation, and the mechanism might be associated with mTOR, beta-catenin, and hTERT activities.PMID:27188501
Our result showed that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029) and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are related to poorer overall survival (P < 0.001; P < 0.001).PMID:27273823
These data demonstrate that the CXCR2 network and CXCL4 play a role in the maintenance of normal HSC/HPC cell fates, including survival and self-renewal.PMID:27222476
CXCR1 and CXCR2 regulate hepatocyte exosome release. The mechanism utilized by CXCR1 remains elusive, but CXCR2 appears to modulate Nsm activity and resultant production of ceramide to control exosome release. CXCR1 is required for packaging of enzymes into exosomes that mediate their hepatocyte proliferative effect.PMID:27551720
TNF-alpha augments CXCR2 and CXCR3 to promote the progression of renal cell carcinoma leading to a poor prognosis.PMID:27297979
Data indicate that the crystal structure of PDZ-RhoGEF PDZ domain in complex with the CXC chemokine receptor 2 (CXCR2) C-terminal PDZ binding motif.PMID:28179147
Treatment with 1,25D3 increased poly(I:C)-induced IL-8 mRNA and protein expression after 2 to 6 hours. However, when cells were pretreated with 1,25D3 for 24 hours, 1,25D3 decreased cytokine expressionPMID:27196318
we identified novel pathways associated with GPI-AP- granulocytes by RNA-seq and validated higher CXCR2 expression in GPI-AP- than GPI-AP+ granulocytes.PMID:28151558
Results identify the CXCL2/MIF-CXCR2 axis as an important mediator in MDSC recruitment and as predictors in bladder cancer.PMID:27721403
Study shows that CXCR2 signaling in the myeloid compartment is tumor promoting and required for pancreatic cancer metastasis.PMID:27265504
The usefulness of CXCR-2 as potential tumor marker of esophageal cancer was studied.PMID:27906878
this study shows that downregulation of CD182 after stimulation with IL-8 is more pronounced in adults than in neonates, whereas fMLP induces changes in receptor expression that are of the same magnitude in neutrophils from neonates as from adultsPMID:27606963
findings present that miR-940 acts as a pivotal adaptor of CXCR2 and its transcription downregulated CXCR2 expression to decrease HCC invasion and migration in vitro.PMID:27807540
Our findings suggest that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis.PMID:26837773
Data suggest that neutrophil-activating peptide 2 (NAP-2) secreted by NK cells can bind to CXC Chemokine Receptor 2 (CXCR2) on mesenchymal stem cells (MSCs) leading to stimulation of its recruitment.PMID:27052313
High CXCR2 expression is associated with pancreatic cancer.PMID:26771140
The results of this study show that the CXCR2 rs1126579 polymorphism is significantly associated with ischemic stroke, both individually and in combination with the genotype and/or alleles of other chemokine genes.PMID:26648969
These studies provide direct evidence linking the activation of IL8, DNA demethylation and the induction of the OA process with important therapeutic implications therein for patients with this debilitating disease.PMID:26521741
CXCR2 expression is enriched in human atherosclerotic coronary artery.PMID:26287498
CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinomaPMID:26503598
we found the mRNA level of NF-kappaB and IL-8 was higher in gastric ulcer patients, especially in patients with H.pylori-positive gastric ulcer.PMID:26060478
Study shows that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion via binding to its receptor CXCR2.PMID:26058729
CXCR2 positivity combined with postoperative complications is associated with subsequent tumor recurrence in esophageal cancer.PMID:26231560
IL-10 rs1800896,CXCR2 rs1126579 and selected clinical features can be used as markers for septic shock development, but not for decreased survival.PMID:26038959
we investigated the changes in promoter methylation patterns using methylation arrays and observed that the promoters of immunomodulatory factors, COX2 and PTGES, and migration-related factors, CXCR2 and CXCR4, were hypomethylated after 5-aza treatmentPMID:25620445
TLR3 stimulates the differentiation of mesenchymal stromal cells from human tonsils into follicular dendritic cell-like cells and induces chemokine secretion, possibly by recruiting C-X-C chemokine receptor 2-expressing immune cells.PMID:25794662
Data show that long ncRNAs MALAT1 silencing downregulated the expression of the microRNA miR-22-3p target gene CXCR2 and AKT pathway.PMID:26364720
Data revealed a critical role of a PDZ-based CXCR2 macromolecular complex in EPC homing and angiogenesis.PMID:25622052
Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion.PMID:25682075
CXCR2 is a potential independent adverse prognostic biomarker for recurrence and survival of patients with non-metastatic ccRCC after nephrectomy.PMID:26188847
The results showed that H. pylori induced the activation of Jak1/Stat3 and IL-8 production, which was inhibited by a Jak/Stat3 specific inhibitor AG490 in AGS cells in a dose-dependent mannerPMID:25837197
Data indicate that the antibodies bound specifically to CXC chemokine receptor-2 (CXCR2) expressing cells.PMID:25484047
Data indicate the antibodies recognized distinct epitopes of CXC chemokine receptor-2 (CXCR2).PMID:25484064
our results reveal that circulating concentrations of IL-8 and IL-12 increase along with important vascular threatening traits as fasting serum glucose and VLDL-c, respectivelyPMID:25456886
miR141-CXCL1-CXCR2 signaling-induced Treg recruitment regulates metastases and survival of non-small cell lung cancer.PMID:25349304
3'UTR SNP modulates CXCR2 expression, signaling, and susceptibility to lung cancerPMID:25480945
data demonstrate that CXCR2 regulates bone marrow blood vessel repair/regeneration and haematopoietic recovery, and clinically may be a therapeutic target for improving bone marrow transplantation.PMID:25757087