Recombinant Human C-X-C chemokine receptor type 1 (CXCR1)

Code: CSB-CF011672HU
Size:
20μg
20μg100μg
US$6647
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CXCR1
Uniprot NO.
Alternative Names
CXCR1; CMKAR1; IL8RA; C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; CDw128a; High affinity interleukin-8 receptor A; IL-8R A; IL-8 receptor type 1; CD antigen CD181
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-350
Target Protein Sequence
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity.
Gene References into Functions
  1. MACs from Familial hypercholesterolemia (FH)-MACs have an inflammatory phenotype that is characterized by the up-regulation of CCR3, CCR4, and CXCR1 under the control of miR-505-3p. These results suggest a chronic inflammatory condition in FH innate immunity cells that is not reverted by standard lipid-lowering treatment PMID:29457550
  2. Depletion of receptor accessory proteins REEP5 and REEP6 causes a decrease in CXC Chemokine Receptor 1 (CXCR1) signaling. PMID:27966653
  3. increased production of IL-8 associated with neutrophils infiltration into the liver and decreased CXCR1/2 expression on peripheral neutrophils. CXCR1 and CXCR2 expression levels could be served as early markers to predict the severity of acute-on-chronic liver failure. PMID:27974825
  4. Chemokine receptor CXCR1 could be used as an indicator to predict benign or malignant breast disease, and it can even predict the malignancy degree of breast cancer, as well as its invasive ability and prognosis. PMID:28454081
  5. High expression of CXCR1 identified a subgroup of gastric cancer patients who appeared to benefit from 5-FU based adjuvant chemotherapy . PMID:27780937
  6. CXCR1-NFkappaB pathway role in human hepatocyte proliferation PMID:27032929
  7. Study shows that CXCR1 promoted gastric cancer cell proliferation, migration and invasion. PMID:26983663
  8. These data provide rationale that targeting CXCR1/2 with small molecule inhibitors may enhance chemotherapeutic efficacy for the treatment of gastric cancer. PMID:26847910
  9. The results showed that the expression of N-Ac-PGP receptors (CXCR1 and CXCR2) in CESCs was upregulated by N-Ac-PGP. PMID:26302999
  10. These data demonstrate a biological function for mouse Cxcr1 in vivo and indicate that CXCR1-dependent neutrophil effector function is a critical innate protective mechanism of fungal clearance and host survival in systemic candidiasis. PMID:26791948
  11. Report increased expression of CXCR1 in active pulmonary tuberculosis patients and decreased leukocyte oxidative capacity. PMID:26316141
  12. Evaluation of GPER1, EGFR and CXCR1 mRNA/protein expression may be helpful in differential diagnosis of malignant follicular thyroid carcinoma and benign follicular thyroid adenoma. PMID:26617848
  13. G31P blockage of CXCR1 and CXCR2 can inhibit human lung cancer cell growth and metastasis PMID:26087179
  14. levels of CXCR1 and CXCR2 proteins were associated with the capacity of gastric cancer cell migration, while knockdown of their expression inhibited gastric cancer cell migration and invasion abilities in vitro. PMID:25022956
  15. Findings indicate that upregulation of CXCR7 expression is associated with tumor invasion in colorectal cancer. PMID:25051350
  16. These results, showing the inability of p17 to activate CXCR1_300_142, a receptor found to be expressed on immune cells of patients with a low progression of HIV disease, point to a crucial role of p17 in AIDS pathogenesis. PMID:25121556
  17. These results demonstrated that the evaluation of GPER1, EGFR and CXCR1 expression in papillary thyroid carcinoma may be useful in predicting the risk of lymph node metastasis PMID:25031742
  18. Bioluminescence resonance energy transfer and co-immunoprecipitation studies showed that secretases, PAR-2, and CXCR1 colocalize and physically interact in a novel protease/secretase-chemokine receptor network. PMID:24914212
  19. CXCR1 and CXCR2 (rs4674258C/T, rs1008563C/T, rs6723449T/C) were analyzed for association with IL8 levels and with myocardial infarct risk. PMID:24462138
  20. LukED recognition of CXCR1 and CXCR2 promotes the killing of monocytes and neutrophils in vitro. PMID:24139401
  21. Dual antagonism of CXCR1 inhibits neutrophil chemotaxis in alveolar macrophages from chronic obstructive pulmonary disease patients. PMID:23912333
  22. our results establish a new role of CXCR1 in airway smooth muscle cell migration PMID:23904157
  23. The CXCR1 polymorphism, rs2234671 was found to be associated with chronic HBV infection and may play a role in disease activity. PMID:23396733
  24. HPV 16 E6 up-regulates pro-angiogenic MMP-2 and MMP-9 through inducing IL-8 expression in lung cancer cells. PMID:23349885
  25. this study demonistrated that CX3CR1 in microglia was required for the survival of layer V neurons in mice. PMID:23525041
  26. Findings indicate that Leu128(3.43) and Val247(6.40) are critical for G protein coupling and activation of signaling effectors, providing a valuable insight into the mechanism of CXCR1 activation. PMID:22936990
  27. three-dimensional structure of human CXCR1 determined by NMR spectroscopy PMID:23086146
  28. The proportions of IL-18Ralpha-expressing T lymphocytes and CD8(+) T lymphocytes were significantly higher in stable COPD patients than in nonsmokers and current smokers. PMID:22489883
  29. The data do not support the hypothesis that bronchoepithelial expression of CXCR1 facilitates transepithelial migration of neutrophils. PMID:22076427
  30. Data show that expression of CXCR1 and CXCR2 on neutrophils was significantly decreased in AAV patients compared to healthy controls (HC). PMID:22152684
  31. HIV-1 matrix protein p17 promotes angiogenesis via chemokine receptors CXCR1 and CXCR2. PMID:22904195
  32. It was shown that four SNPs in CXCR1 and three in CXCR2 strongly correlated with age-adjusted lung function in cystic fibrosis patients. SNPs comprising haplotypes CXCR1_Ha and CXCR2_Ha were in high linkage disequilibrium. PMID:22088968
  33. The polymorphism rs2234671 in the CXCR1 gene was not associated with the susceptibility to chronic periodontitis in the studied Brazilian population PMID:22051099
  34. synergistic effect of CXCR1 and CXCR2 in shear-stress-induced endothelial cell migration PMID:21989491
  35. The N-terminal element of CXCR1 receptor, when attached to the N-terminus of the stabilized B1 domain, binds to IL-8. This binding is characterized by a small favorable enthalpy change and a larger favorable entropy change. PMID:22242662
  36. Optimization of purification and refolding of the human chemokine receptor CXCR1 improves the stability of proteoliposomes for structure determination. PMID:22024025
  37. association between CXCR1/CXCR2 variants and visceral leishmaniasis PMID:22171941
  38. mRNA levels for CXCR1 and CXCR2 are increased in blood in males with obstructive CAD and decreased in patients with improved perfusion. PMID:21915051
  39. Data demonstrate that blocking megakaryopoiesis by simultaneous inhibition of CXCR1 and CXCR2 can enhance differentiation of UCB CD133(+) cells into megakayocytic progenitors. PMID:21555225
  40. CXCR1 and CXCR2 are important factors in mediating the migration of endothelial cells induced by shear stress, and CXCR1 fulfills a more important role. PMID:19634663
  41. local and global dynamics of the chemokine receptor CXCR1 PMID:21323370
  42. The donor GA/AA genotypes of CXCR1 -2668G/A (rs2671222) were associated with increased risk for acute rejection even after adjusting for gender, diabetes, preemptive transplantation, immunosuppressives, relationship with the donor, and HLA mismatch. PMID:21452410
  43. CXCR1 and CXCR2 are novel mechano-sensors mediating laminar shear stress-induced endothelial cell migration. PMID:21036625
  44. Marked induction of CXCR1 expression on Foxp3-positive CD4 regulatory T cells by interleukin (IL)-6 followed by IL-8-mediated migration appears to be responsible for enriched migration of healthy donor mononuclear leukocytes to cultured tumor cells. PMID:21048114
  45. The CXCR-1 receptor, but not the CXCR-2 receptor was found to be expressed in human small airway epithelial cells. PMID:20016196
  46. CMV uses the UL146 gene product expressed in infected endothelial cells to attract neutrophils by activating their CXCR1 and CXCR2 receptors, whereby neutrophils can act as carriers of the virus to uninfected endothelial cells PMID:20044480
  47. Case-control analysis showed association between the common C allele (OR 2.38; 95% CI 1.23-4.57; P = 0.009) of CXCR1_rs2854386 and cutaneous leishmaniasis. PMID:20089160
  48. When reflux was excluded, 54% of the patients had CXCR1 sequence variants. The UTI prone children expressed less CXCR1 protein than the pediatric controls (p<0.0001) and two sequence variants were shown to impair transcription PMID:17786197
  49. Data demonstrate that CXCR1 and CXCR2 expression play a critical role in melanoma tumor progression and, functional blockade of CXCR1 and CXCR2 could be potentially used for future therapeutic intervention in malignant melanoma. PMID:19585580
  50. Data show that CXCR1 is expressed in neutrophils in inflamed human stomach and gut tissues. PMID:12002274

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 6026

UNIGENE: Hs.194778

KEGG: hsa:3577

STRING: 9606.ENSP00000295683

OMIM: 146929

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products