QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYI YFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGM LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSS EQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKV IIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPF LYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
Gene References into Functions
Results suggest that chemokine (C-C motif) receptor 7 (CCR7)promotes triple-negative breast cancer (TNBC) metastasis and may serve as a target for breast cancer diagnosis and treatment.PMID:30032244
High CCR7 expression is associated with urinary bladder cancer metastasis.PMID:28534984
these data indicate CCL19/CCR7 contributes to proliferation and invasion of ESCs, which are conducive to the pathogenesis of endometriosis through activating PI3K/Akt pathwayPMID:28856757
The research findings demonstrate for the first time that the chemokines CCL19, CCL21 and CCR7 play important roles in bone destruction by increasing osteoclast migration and resorption activity, and that has been linked to rheumatoid arthritis pathogenesis.PMID:28729639
CXCR4, CCR7, VEGF-C and VEGF-D expression might have synergistic effects on the lymph node metastasis in patients with cervical cancer.PMID:28535405
the acute GvHD (aGvHD) patients received higher percentage of CD4+CCR7+ T-cells in donor T-cells, whereas chronic GvHD (cGvHD) patients were transplanted with higher percentages of CD8+CCR7+ T-cells. Functional experiments demonstrated that CCR7+ T-cells exhibited higher potential for activation than CCR7- T-cells did.PMID:28112745
these results demonstrated that CCL21/CCR7 may activate EMT in lung cancer cells via the ERK1/2 signaling pathway.PMID:28487957
CCL21/CCR7 interaction was shown to allow NK cell adhesion to endothelial cells (ECs) and its reduction by hypoxia.PMID:28416768
Study shows that miR-1275 can positively regulate CCR7 expression in squamous cell carcinoma of head and neck (SCCHN) with different mechanisms.PMID:29278769
Study provide evidence that CCR7 mediates EMT progress via AKT pathway, which indicates that CCR7 has a key role in breast cancer progression.PMID:28378417
Report an increased percentage of peripheral CCR7 T cells accompanied by endothelial dysfunction in patients with ankylosing spondylitis.PMID:28421995
The analysis of gene amplification and mRNA levels showed the expression of CCR7 in breast cancer correlated with better prognosis.PMID:28930757
that CCR7 mediates TGF-beta1-induced MMP2/9 expression through NF-kappaB signalingPMID:28817313
leukocyte subsets express distinct patterns of CCR7 sialylation that contribute to receptor signaling and fine-tuning chemotactic responses.PMID:26819318
tumor microenvironment stimulation down-regulated the migration of CCR7-expressing tumor cells toward CCL21 and inhibited the formation of directional protrusions toward CCL21 in a novel 3-dimensional hydrogel system.PMID:26936935
CCR7 expression levels in human tumors correlate with signatures of CD141(+) DC, intratumoral T cells, and better clinical outcomes.PMID:27424807
specific role for CCL21/CCR7 in promoting EMT and metastasis in CD133+ pancreatic cancer stem-like cellsPMID:27505247
This study showed that CCR7 are overexpressed in CD4(-) CD8(-) thymocytes of myasthenia gravis patients.PMID:26616645
High tumoral CCR7 expression correlated with potential lymphatic involvement and poor prognosis of metastatic renal cell carcinoma patients treated with tyrosine kinase inhibitors.PMID:28114889
Results show that upregulation of CCR7 promotes cell proliferation and inflammation in A549 non-small cell lung cancer cells. However, silencing of CCR7 via siRNA treatment promotes cell apoptosis and suppresses the inflammatory response and TGF-beta1-induced EMT, which may be associated with NF-kappaB signaling.PMID:28339080
Down-regulating CCR7 expression in MG63 cells could apparently inhibit cell proliferation, migration and invasion abilities of MG63 cells, and also induce cell apoptosis.PMID:27916085
These results suggest that upregulation of rat CCR7 expression does not change the phenotype, differentiation, or proliferation capacity of human adipose-derived stem cells (hASCs), but does enable efficient migration of hASCs to rat secondary lymphoid organs.PMID:28035134
CCL21/CCR7 interaction contributes to the time-dependent proliferation of PTC cells by upregulating cyclin A, cyclin B1 and cyclin-dependent kinase 1 (CDK1) expression via the extracellular signal-regulated kinase (ERK) pathway associated with iodine.PMID:27574129
we conclude that CCR7 gene locus harbours a polymorphism that modifies risk of MI in patients with Coronary artery disease (CAD). Replication of this association could be sought in a prospective cohort of initially healthy individualsPMID:27317472
this study shows that plasmacytoid dendritic cells from rheumatoid arthritis patients have high expression levels of CCR7PMID:27421624
This study suggests that NRP1 expression and LVD are independent factors that are likely to predict the risk of LN metastasis in squamous cell carcinoma (SCC)of the tongue, whereas the expression of VEGFC, VEGFR3, CCR7, and SEMA3E are nonindependent predictive factorsPMID:27666723
High CCR7 expression is associated with gastric cancer.PMID:26984468
CCR7 pathway up-regulates Twist expression via ERK and PI3K/AKT signaling to manage the epithelial-mesenchymal transition of pancreatic ductal adenocarcinomaPMID:26219899
Constitutively expressed Siglec-9 inhibits LPS-induced CCR7, but enhances IL-4-induced CD200R expression in human macrophages.PMID:26923638
High CXCR4 expression in primary breast tumors (PTs) was found to be associated with luminal A type tumor, suggesting more favorable outcome. In contrast, CCR7 and FOXP3 expressions in PTs represented luminal B tumors, pointing to more aggressive tumor behavior. Maspin expression did not differ between luminal types.PMID:28011488
Results indicated that CCR7 is overexpressed in gallbladder cancer tissues and its expression correlates with staging and lymph node metastasis.PMID:27009073
CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via ERK/Akt pathway in lung cancer.PMID:26884842
The present study demonstrated that down-regulation of CCR7 reduced proliferation, cell cycle, cell migration and invasion in prostate cancer cellsPMID:26722441
Our findings suggested that MUC1 plays an important role in CCL21-CCR7-induced lymphatic metastasis and may serve as a therapeutic target in esophageal squamous cell carcinoma .PMID:26667143
Membrane associated PGES1dependent release of PGE2 is ccompanied by elevated CCR7 expression in colon cancer cells.PMID:26352871
Pyk2 is a key downstream signaling molecules of CCR7 in SCCHN, which promotes SCCHN tumorigenesis and progression.PMID:26352169
the CCR7 axis mediates TGF-beta1-induced EMT via crosstalk with NF-kappaB signaling, facilitating lymph node metastasis and poorer overall survival in patients with gastric cancerPMID:26176983
Blockade of CCR7, or treatment with a p38 MAP kinase inhibitor, reduced lymphatic dissemination of epithelial-mesenchymal transition cells.PMID:25961925
findings indicated that circulating memory Tfh cells, especially CCR7+ICOS+ memory Tfh cells, may be associated with the relapse of MS and may serve as a new therapeutic targetPMID:26231034
The chemotactic interaction between CCR7 and its ligand, CCL21, may be a critical event during progression in pancreatic cancerPMID:21594558
CrkL regulates CCL19 and CCR7-induced epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinoma patients.PMID:25636509
Recycling accounts, to a major extent, for the high levels of surface CXCR4/CCR7 on CLL cells. Increased CCR4/CCR7 is detectable not only in circulating leukemic cells, but also in secondary lymphoid organs of CLL patients with lymphoadenopathy.PMID:26282174
in given donor/recipient pairs, KIR2DS4 expression may contribute to potentiating natural killer cell function by increasing both the cytotoxicity and the expression of CCR7 on their surface.PMID:25961063
Data indicate that inhibition of TGF-beta-activated protein kinase 1 (TAK1) reduces chemokine (C-C motif) receptor 7 (CCR7) expression.PMID:25557171
CCL21/CCR7 pathway activates signallings to up-regulate Slug pathway, leading to the occurrence of epithelial-mesenchymal transition process in human chondrosarcomaPMID:25556164
our study suggested that CCR7 promotes Snail expression to induce the epithelial-mesenchymal transition, resulting in cell cycle progression, migration, and invasion in gastric cancerPMID:25572817
High CCR7 expression was associated with colorectal cancer metastasis.PMID:26179425
The solution structure of CCL19 is reported. It contains a canonical chemokine domain. Chemical shift mapping shows the N-termini of PSGL-1 and CCR7 have overlapping binding sites for CCL19 and binding is competitive.PMID:26115234
These results reveal that CCR7 and VEGF-C display a significant crosstalk and suggest a novel role of the CCL21/CCR7 chemokine axis in the promotion of breast cancer-induced lymphangiogenesis.PMID:25744065
High expression of CCR-7 is associated with atherosclerotic arteries.PMID:25318003
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.