Recombinant Human C-C chemokine receptor type 10 (CCR10)

CSB-CF004840HU
Size:
20μg
20μg100μg
US$5203
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
CCR10
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-362
Target Protein Sequence
MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG LVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLY SASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFS QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGP ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSW DN
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for chemokines SCYA27 and SCYA28. Subsequently transduces a signal by increasing the intracellular calcium ions level and stimulates chemotaxis in a pre-B cell line.
Gene References into Functions
  1. CCR10 may be a key regulator in breast cancer cell invasion and migration PMID:28830025
  2. CCR10/CCL27 crosstalk mediated drug resistance, contributing to failure of proteasome-inhibitors in multiple myeloma. PMID:27732933
  3. CCL27 drives baseline recruitment of Herpes simplex virus-specific CD8 T cells expressing CCR10, while interferon-responsive CXCR3 ligands recruit additional cells in response to virus-driven inflammation. PMID:28701399
  4. The chemokine receptor CCR10 is highly expressed in human glioblastoma compared with control brain tissue. PMID:25149529
  5. Findings support the notion that CCR10 and its ligand CCL27 may contribute to the skin infiltration of malignant T-cells in mycosis fungoides and adult T-cell leukemia/lymphoma. PMID:24970722
  6. low CCL27/CCR10 and CXCL12/CXCR4 intratumoral mRNA ratios are associated with melanoma progression PMID:22526457
  7. CCR7 overexpression correlated with expression of metallothionein, while CCR10 was associated with cerebral metastases. CCR7 and CCR10 overexpressions were associated with a worse outcome independent of Breslow's tumor thickness and Clark level. PMID:22350183
  8. unlike blood plasmacytoid dendritic cells (pDCs), a subset of tonsil pDCs express functional CCR6 and CCR10, and their respective ligands CCL20 and CCL27 are detected in inflamed epithelia PMID:21937703
  9. The high fraction of circulating IgA+ and IgG+ B cells expressing CCR9 and CCR10 in the first months of life indicates activation of naive B cells in the gut, coinciding with bacterial colonization. PMID:21075690
  10. TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells. PMID:20947433
  11. CCR10 and its ligand CCL27 may contribute to the skin infiltration of malignant T-cells in cutaneous T-cell lymphoma. PMID:15700309
  12. gene expression of CCR10 was increased by recombinant ANXA1 and the N-terminal ANXA1 peptide PMID:16460738
  13. CCR10-CTACK/CCL27 interactions between circulating T cells and keratinocytes would seem to play an important role in the pathophysiology of mycosis fungoides. PMID:16675558
  14. CCR10 allows T regulatory (Treg) cells recruited to chronically inflamed liver tissues to respond to CCL28 secreted by epithelial cells, resulting in the accumulation of CCR10+ Tregs at mucosal surfaces. PMID:16785557
  15. CCR4 and CCR10 may play an important role in ATLL invasion into the skin PMID:17071491
  16. CCR4 and CCR10 are expressed on epidermal keratinocytes and that both are functional in terms of skin cytokine production and/or migration to their ligand CCL17 and CCL27, respectively. PMID:18782672

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed at high levels in adult testis, small intestine, fetal lung, fetal kidney. Weaker expression was observed in many other adult tissues including spleen, thymus, lymph node, Peyer patches, colon, heart, ovary, peripheral blood lymphocytes, thyroid
Database Links

HGNC: 4474

UNIGENE: Hs.744542

KEGG: hsa:2826

STRING: 9606.ENSP00000332504

OMIM: 600240

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products