Home
Product
Protein
Transmembrane Proteins
Recombinant Human C-C chemokine receptor-like 2 (CCRL2)

Recombinant Human C-C chemokine receptor-like 2 (CCRL2)

CSB-CF004852HU

Rate （N/A）
Review （0）

Size:

20ug100ug

US$1620

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Promotion

Transmembrane Protein Questionnaire with Gifts

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CCRL2

Uniprot NO.

O00421

Research Area

Immunology

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-344aa

Target Protein Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Mol. Weight

45.6 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

Recombinant Human C-C chemokine receptor-like 2 (CCRL2)

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses.

Gene References into Functions

CCRL2 mRNA was not significantly changed in murine and human non-alcoholic steatohepatitis liver. CCRL2 mRNA levels were positively correlated with inflammation, fibrosis and NASH scores in the patients. PMID:28600126
CCRL2 inhibited the growth of breast cancer cells in vitro and in vivo. PMID:26487662
in breast cancer, CRAM-A becomes specifically upregulated under inflammatory stimuli and may serve as a potential marker of immune response. PMID:26563945
these results suggest for the first time that elevated CCRL2 in glioma promotes cell migration and invasion. PMID:23142225
Considering the newly defined role of CCRL2 in lung dendritic cell trafficking, this atypical chemokine receptor may affect pneumocystis pneumonia through immune regulation and inducing inflammation. PMID:22046140
demonstration that the homeostatic chemokine CCL19 is a specific ligand for CRAM PMID:20002784
CCRL2 expression is up-regulated on synovial neutrophils of rheumatoid arthritis patients PMID:15188357
Results identify chemerin as a natural nonsignaling protein ligand for both human and mouse CCRL2. PMID:18794339

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (both CD4+ and CD8+), mo

Database Links

HGNC: 1612

UNIGENE: Hs.535713

KEGG: hsa:9034

STRING: 9606.ENSP00000349967

OMIM: 608379

Promotions