IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKK DKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQ CNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQ EGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAK RQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLS RNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSH VFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYR QQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPA GTTD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Alkaline phosphatase that can hydrolyze various phosphate compounds.
Gene References into Functions
This meta-analysis suggests that high serum ALP level is obviously associated with lower OS rate in patients with osteosarcoma, and it is an effective biomarker of prognosis.PMID:29970708
Concentrations of PLAP were elevated in gingival crevicular fluid of patients with pre-eclampsia.PMID:26988336
SALL4 also outperformed PLAP on a small sample of cytology blocks. Although SALL4 is not entirely specific, it is a highly sensitive marker with strong diffuse nuclear reactivity in the majority of MGCTs in the posttreatment setting, at significantly higher levels than PLAPPMID:25906119
Quantum-mechanical computational methods were employed to study the catalytic mechanism of human placental AP (PLAP). An active-site model was used, constructed on the basis of the X-ray crystal structure of the enzyme.PMID:25409280
term placental explants, but not their conditioned medium, can de-phosphorylate IGFBP-1 through the action of placental alkaline phosphatasePMID:24856042
Anti-PLAP antibodies may serve as a modular building blocks for the development of targeted therapeutic products, armed with cytotoxic drugs, radionuclides or cytokines as payloads.PMID:24247025
A candidate gene, ALPP, encoding the placental alkaline phosphatase, was identified as being potentially involved in recurrent spontaneous abortion.PMID:24296104
The objective of the following study was to record the specificity and sensitivity of alpha5(IV) loss, smoothelin expression and PLAP expression as markers of gastrointestinal smooth muscle neoplasmsPMID:24043717
Data indicate that p180 is required for the efficient targeting of placental alkaline phosphatase (ALPP) mRNA to the endoplasmic reticulum (ER).PMID:24019514
Calculation of the electrostatic potentials within the active site of human placental alkaline phosphatase also suggests that the local positive electrostatic environment may account for its capability to distinguish various substratesPMID:21910833
High serum alkaline phosphatase cooperating with MMP-9 is associated with metastasis in patients with primary osteosarcoma.PMID:22333159
PLAP exerts a positive effect on DNA replication and acts as a proliferative factor in trophoblastic cells.PMID:21868091
The proximity of undifferentiated gonadal tissue with the tumors as well as the immunostaining patterns (PLAP+, OCT3/4+, and CD117/KIT+) suggests that germ cells found in them are a risk factor for gonadal tumors.PMID:21692598
the catalytic mechanism of human placental alkaline phosphatasePMID:21939286
Data show that serum alkaline phosphatase, Gleason score, and intensity of bone metastasis are important and statistically significant prognostic factors, and affects time to progression and life time.PMID:19450995
at a certain time point during adrenocortical development, some fetal zone cells survive owing to defective apoptosis and develop into childhood ACT, maintaining some characteristics of the embryonal period, such as PLAP expressionPMID:21516013
Serum total calcium (r -0.1362, p<0.001), serum inorganic phosphate (r -0.45, p<0.001) and serum alkaline phosphatase (r -0.5587, p<0.001) have shown inverse relationship with age.PMID:20655896
High serum alkaline phosphatase is associated with chronic kidney disease.PMID:20299338
differential expression of Pl(1) and Pl(2) probably results from linkage disequilibrium with the sequence variation rs2014683G>A in the ALPP gene promoter that was shown to have allele-specific binding patterns to placental nuclear proteins.PMID:20663553
structure of placental alkaline phosphatase with pNPP contained only p-nitrophenol in three distinct sites, while the structure with 5'-AMP contained the p-nitrophenyl group in two of the sites instead of 5'-AMPPMID:20693656
Low magnitudes of tensile strain enhance expression of alkaline phosphatase in human osteoblasts.PMID:19595020
The PLAP D allele contains two amino acid substitutions: P209R (692C>G) and E429G (1352 A>G).PMID:11857742
Proximity of the protein moiety of a GPI-anchored protein to the membrane surface: a FRET study.PMID:12081485
the beta-N-acetylglucosaminyl phosphate diester residue is attached to the glycosylphosphatidylinositol anchor of human placental alkaline phosphatase and is a target of the channel-forming toxin aerolysinPMID:12851398
receptor for Aeromonas sobria hemolysin.PMID:15715171
analysis of human placental alkaline phosphatase in complex with functional ligandsPMID:15946677
The effect of parity on placental weight and birth weight is examined through a series of birth records from an Indian population in Calcutta.PMID:16431676
crystal structure of strontium-substituted human placental alkaline phosphatase shows that strontium substitutes the calcium ion with concomitant modification of the metal coordinationPMID:16815919
activity of GPI-anchored enzymes may be modulated by membrane microenvironment featuresPMID:18416535
Serum bilirubin, alkaline phosphatase, and aspartate aminotransferase are an efficient set of biochemistries to identify UDCA-treated patients with primary biliary cirrhosis at risk of death or liver transplantation (LT).PMID:18752324
Elevations of alkaline phosphatase is associated with therapy related pediatric cancer.PMID:18802949