MSTESMIRDVELAEEELAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQREEQLPNAFQSINPLAQTLRSSSRTPSDKPVAHVVANPQAEGQLQWLSGRANALLANGVKLTDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLAVSYPSKVNLLSAIKSPCHTESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDFAESGQVYFGIIAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Gene References into Functions
The results obtained showed that IL-6 expression in adipose tissue biopsies derived from animals with equine metabolic syndrome was enhanced while TNF-alpha levels of both groups were comparable.PMID:25269712
Data indicate that tumor necrosis factor-alpha production is closely related to ovarian steroid actions.PMID:24642167
These results indicate that in equine corpus luteum, cytokines TNF, IFNG and FASL regulate nitric oxide activity, via eNOS expression modulation.PMID:23941776
These data show the presence of cytokines TNF and IFNG, and their receptors, in the equine corpus luteum and indicate their potential involvement in regulation of luteal function.PMID:22186103
These results suggest that basal oxidative stress markers, circulating cytokines and anti-inflammatory neuroendocrine hormones appear to correlate with endurance performance in horses.PMID:21058993
The contribution of bronchial epithelium to airway inflammation, with focus on mRNA and protein expression of IL-6, IL-10 and TNF-alpha, in horses with recurrent airway obstruction during exacerbation and in remission is reported.PMID:18294392
The effects of semen extender and seminal plasma on the expression of inflammatory modulators in the endometrium of mares are reported.PMID:18584861
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.