Home
Product
Protein
Transmembrane Proteins
Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)

Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)

Code: CSB-CF360981EFA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3924

Quantity:

Express system: in vitro E.coli expression system

Species: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Tag Info: 10xHis-SUMO-tag

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

BHRF1

Uniprot NO.

P03182

Alternative Names

BHRF1Apoptosis regulator BHRF1; Early antigen protein R; EA-R; Nuclear antigen

Species

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Source

in vitro E.coli expression system

Expression Region

1-191

Target Protein Sequence

MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI CSYLFISRGRH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Prevents premature death of the host cell during virus production, which would otherwise reduce the amount of progeny virus. Acts as a host B-cell leukemia/lymphoma 2 (Bcl-2) homolog, and interacts with pro-apoptotic proteins to prevent mitochondria permeabilization, release of cytochrome c and subsequent apoptosis of the host cell.

Subcellular Location

Host membrane; Single-pass membrane protein. Host mitochondrion. Note=also observed in the perinuclear region of the cell.

Protein Families

Bcl-2 family

Database Links

KEGG: vg:3783706

Promotions