Home
Product
Protein
Transmembrane Proteins
Recombinant Dog C-X-C chemokine receptor type 4 (CXCR4)

Recombinant Dog C-X-C chemokine receptor type 4 (CXCR4)

Code: CSB-CF668610DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5136

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CXCR4

Uniprot NO.

Q3LSL6

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

1-353

Target Protein Sequence

MEELHIYPSDNYTEEDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVEAVANWYFGNFLCKAVHVIYTVN LYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVRE ADDRYICDRFYPNDSWLVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGYQKRKALK TTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFEKTVHKWISITEALAFFHCCLNP ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade. Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.

Gene References into Functions

interaction with CXCL12 to promote cell migration and invasion of hemangiosarcoma PMID:26337509
Clusterin expression may increase cardiac progenitor cell migration via increasing CXCR4 expression and SDF-1/chemokine receptor signaling in a PI3/Akt-dependent manner. PMID:20813109
CXCR4 is excluded as the cause of trapped neutrophil syndrome in Border Collies. PMID:16441310
The amino acid sequence encoding CXCR4 showed the structural characteristics of seven transmembrane domain G protein-coupled receptors. PMID:17316828
The expression of CXCR4 in canine immortalized cell lines and naturally occurring tumor samples and the role of CXCR4 in cell migration in cell lines are reported. PMID:18466248