Recombinant Dog Adenosine receptor A2a (ADORA2A)

Code: CSB-CF001376DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5577

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ADORA2A

Uniprot NO.

P11617

Alternative Names

ADORA2A; RDC8; Adenosine receptor A2a

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

1-412

Target Protein Sequence

MSTMGSWVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI PFAITISTGFCAACHNCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR AKGIIAVCWVLSFAIGLTPMLGWNNCSQPKEGRNYSQGCGEGQVACLFEDVVPMNYMVYY NFFAFVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG LFALCWLPLHIINCFTFFCPECSHAPLWLMYLTIVLSHTNSVVNPFIYAYRIREFRQTFR KIIRSHVLRRREPFKAGGTSARALAAHGSDGEQISLRLNGHPPGVWANGSAPHPERRPNG YTLGLVSGGIAPESHGDMGLPDVELLSHELKGACPESPGLEGPLAQDGAGVS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

A(2A) receptors contribute to coronary vasodilation in response to cardiac ischemia via activation of K(V) and K(ATP) channels. PMID:21044214
Report effects of adenosine and a selective A2A adenosine receptor agonist on hemodynamic and thallium-201 and technetium-99m-sestaMIBI biodistribution and kinetics. PMID:19833310
an activation of either A2A and D2 receptor or blockade of D2 receptors will cause long-lasting changes in A2A and D2 receptor trafficking PMID:15784967
The allosteric effect of PD81,723 is maintained in an A1/A2A AR chimaera in which the predominant G-protein-coupling domain of the A1 receptor, the 3ICL, is replaced by A2A sequence, but not in chimaeric receptors with an A1 sequence in the 3ICL. PMID:16390330