Recombinant Dog Adenosine receptor A2a (ADORA2A), partial

Product Details

Purity
>85% (SDS-PAGE)
Target Names
ADORA2A
Uniprot NO.
Alternative Names
ADORA2A; RDC8; Adenosine receptor A2a
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
Yeast
Expression Region
291-412aa
Target Protein Sequence
RIREFRQTFRKIIRSHVLRRREPFKAGGTSARALAAHGSDGEQISLRLNGHPPGVWANGS APHPERRPNGYTLGLVSGGIAPESHGDMGLPDVELLSHELKGACPESPGLEGPLAQDGAGVS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
partial, the last Cytoplasmic domain
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. A(2A) receptors contribute to coronary vasodilation in response to cardiac ischemia via activation of K(V) and K(ATP) channels. PMID:21044214
  2. Report effects of adenosine and a selective A2A adenosine receptor agonist on hemodynamic and thallium-201 and technetium-99m-sestaMIBI biodistribution and kinetics. PMID:19833310
  3. an activation of either A2A and D2 receptor or blockade of D2 receptors will cause long-lasting changes in A2A and D2 receptor trafficking PMID:15784967
  4. The allosteric effect of PD81,723 is maintained in an A1/A2A AR chimaera in which the predominant G-protein-coupling domain of the A1 receptor, the 3ICL, is replaced by A2A sequence, but not in chimaeric receptors with an A1 sequence in the 3ICL. PMID:16390330

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1