Home
Product
Protein
Transmembrane Proteins
Recombinant Danio rerio Sphingosine 1-phosphate receptor 1 (s1pr1)

Recombinant Danio rerio Sphingosine 1-phosphate receptor 1 (s1pr1)

Code: CSB-CF875293DIL

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5203

Quantity:

Express system: in vitro E.coli expression system

Species: Danio rerio (Zebrafish) (Brachydanio rerio)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

s1pr1

Uniprot NO.

Q9DDK4

Alternative Names

s1pr1; edg1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1

Species

Danio rerio (Zebrafish) (Brachydanio rerio)

Source

in vitro E.coli expression system

Expression Region

1-362

Target Protein Sequence

MDDLIARHYNFTGKFRKVHKDPGLKADSVVFIIVCCFIILENVLVLLTIWRTKKFHKPMY YFIGNLALSDLLAGVVYTANILLSGANTYKLTPTQWFFREGSMFVALAASVFSLLAIAIE RHLTMLKMKLHNNGKTCRVFMLISTVWFIAAILGGLPVMGWNCIDSMNNCSTVLPLYHKA YILFCTTVFSVILMAIVILYARIYALVRTRSRKLVFRKVANGRGSNKSSEKSMALLKTVI IVLSCFIACWAPLFILLLLDVACQTLTCSILYKAEWFLALAVLNSAMNPLIYTLTSNEMR RAFIKMLNCGVCVQPSGKFSRPIMGAEFSRSKSDNSSHPNKDEPEYSPRETIVSSGNITS SS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate.

Gene References into Functions

Wnt/beta-catenin signaling regulates VE-cadherin-mediated anastomosis of brain capillaries by counteracting S1pr1 signaling in the process of neovascularization of the central nervous system and blood-brain barrier formation. PMID:30451830
Individual s1prs showed unique expression patterns with some overlapping expression domains during early embryogenesis. PMID:26094551
Sphingosine 1-phosphate receptor signaling regulates proper embryonic vascular patterning PMID:23229546
Report role for S1PR1 in regulation venous endothelial barrier function. PMID:22837470