Recombinant Danio rerio Sphingosine 1-phosphate receptor 1 (s1pr1)

Code: CSB-CF875293DIL
Size:
20μg
20μg100μg
US$5203
Quantity:
Express system: in vitro E.coli expression system
Species: Danio rerio (Zebrafish) (Brachydanio rerio)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
s1pr1
Uniprot NO.
Alternative Names
s1pr1; edg1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Source
in vitro E.coli expression system
Expression Region
1-362
Target Protein Sequence
MDDLIARHYNFTGKFRKVHKDPGLKADSVVFIIVCCFIILENVLVLLTIWRTKKFHKPMY YFIGNLALSDLLAGVVYTANILLSGANTYKLTPTQWFFREGSMFVALAASVFSLLAIAIE RHLTMLKMKLHNNGKTCRVFMLISTVWFIAAILGGLPVMGWNCIDSMNNCSTVLPLYHKA YILFCTTVFSVILMAIVILYARIYALVRTRSRKLVFRKVANGRGSNKSSEKSMALLKTVI IVLSCFIACWAPLFILLLLDVACQTLTCSILYKAEWFLALAVLNSAMNPLIYTLTSNEMR RAFIKMLNCGVCVQPSGKFSRPIMGAEFSRSKSDNSSHPNKDEPEYSPRETIVSSGNITS SS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate.
Gene References into Functions
  1. Wnt/beta-catenin signaling regulates VE-cadherin-mediated anastomosis of brain capillaries by counteracting S1pr1 signaling in the process of neovascularization of the central nervous system and blood-brain barrier formation. PMID:30451830
  2. Individual s1prs showed unique expression patterns with some overlapping expression domains during early embryogenesis. PMID:26094551
  3. Sphingosine 1-phosphate receptor signaling regulates proper embryonic vascular patterning PMID:23229546
  4. Report role for S1PR1 in regulation venous endothelial barrier function. PMID:22837470

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

UNIGENE: Dr.77753

KEGG: dre:64617

STRING: 7955.ENSDARP00000062632

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products