ERCPSPPCECRQEDDFRVTCKDIQSIPSLPPSTQTLKFIETHLKTIPSRAFSNLPNISRI YLSIDATLQQLESHSFYNLSKVTHIEIRNTRSLTYIDSGALKELPLLKFLGIFNTGLRVF PDLTKIYSTDVFFILEITDNPYMTSIPANAFQGLCNETLTLKLYNNGFTSIQGHAFNGTK LDAVYLNKNKYLTVIGQDAFAGVYSGPTLLDISYTSVTALPSKGLEHLKELIARNTWTLR KLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILQSLMCNESSIRGLRQRKSASALNGP FYQEYEDLGDGSAGYKENSKFQDTQSNSHYYVFFEEQEDEIIGFGQQLKNPQEETLQAFD SHYDYTVCGGSEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNVFVLVILLTS HYKLTVPRFLMCNLAFADFCMGLYLLLIASVDLYTQSEYYNHAIDWQTGPGCNTAGFFTV FASELSVYTLTVITLERWHAITFAMRLDRKIRLWHAYVIMLGGWVCCFLLALLPLVGISS YAKVSICLPMDTETPLALAYIILVLLLNIIAFIIVCACYVKIYITVRNPHYNPGDKDTRI AKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSKILLVLFYPLNSCANPFLYAIFT KAFQRDVFMLLSKFGICKRQAQAYRGQRVSPKNSTGIRVQKVPPDVRQSLPNVQDDYELL ENSHLTPKQQDQTSKEYKRTVL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for the thyroid-stimulating hormone (TSH) or thyrotropin. Also acts as a receptor for the heterodimeric glycoprotein hormone (GPHA2:GPHB5) or thyrostimulin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Plays a central role in controlling thyroid cell metabolism.
Gene References into Functions
Localization of thyrotropin receptor and thyroglobulin in the bovine corpus luteum.PMID:19553036
analysis of activation switch in the thyrotropin receptorPMID:15722344
Rhes can interfere with the functional activity of wt and mutated TSHr.PMID:17556863
Increased receptor binding by bovine (b) TSH bound to monoclonal antibody to bTSHbeta-subunit.PMID:18202525
the hinge region represents an extracellular intermediate connector for both hormone binding and signal transduction of the thyroid stimulating hormone receptorPMID:18441013