Home
Product
Protein
Transmembrane Proteins
Recombinant Bovine Platelet-activating factor receptor (PTAFR)

Recombinant Bovine Platelet-activating factor receptor (PTAFR)

Code: CSB-CF018946BO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5054

Quantity:

Express system: in vitro E.coli expression system

Species: Bos taurus (Bovine)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

PTAFR

Uniprot NO.

Q9TTY5

Alternative Names

PTAFR; PAFR; Platelet-activating factor receptor; PAF-R; PAFr

Species

Bos taurus (Bovine)

Source

in vitro E.coli expression system

Expression Region

1-342

Target Protein Sequence

MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGILLSLIIWVSIVGAASYFFVLDSTNREPNKTGSANITRCFEHYEKG SIPVLTIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQIQRNAEVKRRALWMVCTVLAV FIICFVPHHLVQLPWTLAELGFQDTDFHQAINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVMQLKDVPVKSLKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system. May be involved in the morphological and physical modifications of the oviduct and uterus during the estrus cycle and early pregnancy.

Gene References into Functions

PAF and luteinizing hormone signaling plays an important role in regulating the production of excessive oxidants. PMID:19565634
The results provide clear evidence for expression of PAFr in bovine granulosa cells and its functional involvement in PAF/PAFr-mediated stimulation of cell recruitment. PMID:18021181

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Found in oviductal epithelial and stroma cells. Levels in the oviduct are raised at days 2-4 of both pregnancy and of the estrus cycle. In the endometrium, localization is predominantly to the apical borders of glandular and luminal epithelial cells. Expr

Database Links

UNIGENE: Bt.63372

KEGG: bta:518283

STRING: 9913.ENSBTAP00000038567

Promotions