MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Gene References into Functions
These results indicate dependence of hepatic glucocorticoid and adrenergic receptors on stage of maturation in neonatal calves and emphasize the association of alpha1-adrenergic receptor and glucocorticoid receptor with neonatal glucose and lipid metabolism.PMID:25497806
relationship between luteal concentrations of oxytocin (OT), noradrenaline (NA), progesterone (P4), oxytocin receptors (OT-R) and beta(2)-adrenoreceptors (beta(2)-R) gene expression and their protein level throughout the estrous cyclePMID:20149890
of the beta-adrenergic receptors, adrenergic beta(2)-receptor type was most highly expressed in the mammary gland of dairy cows followed by beta(1) and beta(3)PMID:12586313
beta 1,2 and 3-adrenergic receptors in cattle were positively associated with hepatic activities of gluconeogenetic enzymes and with plasma glucose levels, suggesting functional importancePMID:15760672
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome. Golgi apparatus.
Expressed in oviduct epithelial cells with high levels during the luteal phase of the sexual cycle. Lower levels around ovulation. Also expressed in liver.