Home
Product
Protein
Transmembrane Proteins
Recombinant Arabidopsis thaliana GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (ALG11)

Recombinant Arabidopsis thaliana GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (ALG11)

Code: CSB-CF894498DOA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5959

Quantity:

Express system: in vitro E.coli expression system

Species: Arabidopsis thaliana (Mouse-ear cress)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ALG11

Uniprot NO.

Q9XEE9

Alternative Names

ALG11; LEW3; At2g40190; T07M07.7; GDP-Man:Man(3GlcNAc(2-PP-Dol alpha-1,2-mannosyltransferase; Alpha-1,2-mannosyltransferase ALG11; Asparagine-linked glycosylation protein 11; Protein LEAF WILTING 3

Species

Arabidopsis thaliana (Mouse-ear cress)

Source

in vitro E.coli expression system

Expression Region

1-463

Target Protein Sequence

MAIYFILYTLLTIIFAVSLSLFLSVINARKSRKRAVGFFHPYTNDGGGGERVLWCAVKAI QEENPDLDCVIFTGDHDSSSDSLARRAVDRFGVHLQSPPKVIHLNKRKWIEESTYPHFTM IGQSLGSVYLAWEALRMFTPLYFLDTSGYAFTYPLARIFGCKVVCYTHYPTISLDMISRV RQRNSMYNNDASIAKSNWLSTCKLVYYRAFSWMYGMVGSCTHLAMVNSSWTKSHIEVLWR IPERITRVYPPCDTSGLQAFPLERSSDPPKIISVAQFRPEKAHMLQLEAFSLALEKLDAD VPRPKLQFVGSCRNNSDEERLQKLKDRAVELKVDGDVQFYKNAMYRELVELLGNAVAGLH GMIDEHFGISVVEYMAAGAIPIAHNSAGPKMDIVLEEDGQKTGFLAETVEEYAEAILEIV KMNETERLKMAESARKRAARFSEQRFCEDFKTAIRPIFTGPLK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Required for N-linked oligosaccharide assembly. Has a role in the last step of the synthesis of the Man(5)GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum.

Gene References into Functions

Positional cloning determined that lrg1 affects an alpha-1,2-mannosyltransferase gene, LEW3, involved in protein N-glycosylation. The lrg1 mutation causes a synonymous substitution that alters the correct splicing of the fourth intron in LEW3, causing a mix of wild-type and truncated protein. LRG1 RNA missplicing in roots and short root phenotypes in lrg1 are light-intensity dependent. PMID:29106622
The lew3 mutation reduces protein glycosylation, impairs cellulose synthesis, and results in xylem collapse. lew3 mutants are more sensitive to salt stress and transpire less water than the wild-type. PMID:19732381

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Protein Families

Glycosyltransferase 4 family

Tissue Specificity

Expressed in shoots, leaves, sepals, filaments, siliques, stems, roots and guard cells.

Database Links

UNIGENE: At.21597

KEGG: ath:AT2G40190

STRING: 3702.AT2G40190.1

Promotions