Recombinant African swine fever virus Envelope protein p54 (Ba71V-126)

CSB-CF731137AEJ
Size:
20μg
20μg100μg
US$3864
Quantity:
Express system: in vitro E.coli expression system
Species: African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Ba71V-126
Uniprot NO.
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Source
in vitro E.coli expression system
Expression Region
1-183
Target Protein Sequence
MDSEFFQPVYPRHYGECLSPVTPPSFFSTHMYTILIAIVVLVIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTD NPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLE NSL
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

The recombinant ASFV Ba71V-126 protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, Ba71V-126 proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.

Ba71V-126, also called envelop protein p54, is a very important ASFV antigenic structural protein. p54 has been localized in the envelope precursors as well as in both intracellular and extracellular mature particles. It is essential for virus viability and takes part in the early steps of virus infection. Studies have shown that p54 is required for the recruitment of envelope precursors to assembly sites and plays a central role in virus growth and the induction of specific antibodies following inoculation of pigs with attenuated virus strains.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Envelope protein involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward viral factories. Seems to induce caspase-3 activation and apoptosis. Plays a role in virion morphogenesis by recruiting and transforming the host ER membranes into the precursors of the viral envelope.
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cytoplasm, host cytoskeleton. Host endoplasmic reticulum membrane.
Protein Families
Asfivirus envelope protein p54 family
Database Links

KEGG: vg:22220355

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products