Home
Product
Protein
Transmembrane Proteins
Recombinant African swine fever virus Envelope protein p54 (Ba71V-126)

Recombinant African swine fever virus Envelope protein p54 (Ba71V-126)

Code: CSB-CF731137AEJ

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3864

Quantity:

Express system: in vitro E.coli expression system

Species: African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ba71V-126

Uniprot NO.

Q65194

Alternative Names

Ba71V-126; E183L; Envelope protein p54

Species

African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Source

in vitro E.coli expression system

Expression Region

1-183

Target Protein Sequence

MDSEFFQPVYPRHYGECLSPVTPPSFFSTHMYTILIAIVVLVIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTD NPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLE NSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Description

The recombinant ASFV Ba71V-126 protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, Ba71V-126 proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.

Ba71V-126, also called envelop protein p54, is a very important ASFV antigenic structural protein. p54 has been localized in the envelope precursors as well as in both intracellular and extracellular mature particles. It is essential for virus viability and takes part in the early steps of virus infection. Studies have shown that p54 is required for the recruitment of envelope precursors to assembly sites and plays a central role in virus growth and the induction of specific antibodies following inoculation of pigs with attenuated virus strains.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Envelope protein involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward viral factories. Seems to induce caspase-3 activation and apoptosis. Plays a role in virion morphogenesis by recruiting and transforming the host ER membranes into the precursors of the viral envelope.

Subcellular Location

Virion membrane; Single-pass membrane protein. Host cytoplasm, host cytoskeleton. Host endoplasmic reticulum membrane.

Protein Families

Asfivirus envelope protein p54 family

Database Links

KEGG: vg:22220355

Promotions