Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR)

CSB-BP335028VAF
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$528
Quantity:
Express system: Baculovirus
Species: Vaccinia virus (strain LC16m8) (VACV)
Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
PS/HR
Uniprot NO.
Research Area
Others
Species
Vaccinia virus (strain LC16m8) (VACV)
Source
Baculovirus
Expression Region
18-92aa
Target Protein Sequence
YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK
Mol. Weight
52.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP335028VAF could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP335028VAF could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.
Protein Families
Receptors of complement activation (RCA) family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products