Home
Product
Protein
Recombinant Proteins
Recombinant Sheep Tumor necrosis factor (TNF), partial

Recombinant Sheep Tumor necrosis factor (TNF), partial

Code: CSB-EP023955SH

Rate （5.0）
Review （1）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$388

Quantity:

Express system: E.coli

Species: Ovis aries (Sheep)

Tag Info: N-terminal GST-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

TNF

Uniprot NO.

P23383

Alternative Names

Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-a

Species

Ovis aries (Sheep)

Source

E.coli

Expression Region

78-234aa

Target Protein Sequence

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

44.2kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : ELISA (Capture)

Review: The minimum detectable dose of sheep TNF-a was: 3.12 pg/ml.

By Anonymous

Target Background

Function(From Uniprot)

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Gene References into Functions

The aim of the study was to assess the prognostic significance of Tumor Necrosis Factor-alpha, Interleukin-12(p40), Interleukin-6 and Interleukin 10 levels in cerebrospinal fluid (CSF) in sheep with encephalitic listeriosis. PMID:25817420
The p38 MAPK inhibitor decreased (P < 0.01) gene expression of TNFa but its effect was not observed at the level of TNFa protein synthesis PMID:24995301
TNF-alpha gene expression in multifidus was greater on both sides in the disc lesion animals than in the muscle of control animals. PMID:24718080
Injection of peptidoglycan-polysaccharide resulted in fever, increased concentrations of TNF-alpha on the day of and the day after challenge, and decreased concentrations of progesterone on days 14 and 21. PMID:20603027
These data are consistent with the effects of LPS on GH secretion originating through peripheral cytokine presentation to the pituitary, as well as a potential to act directly on selective populations of pituitary cells via CD14. PMID:15899940
plasma IL-1 beta, TNF-alpha and MCP-1 may potentially serve as markers to monitor prognosis of pregnancy toxaemia in ewes PMID:17221363

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.

Protein Families

Tumor necrosis factor family

Database Links

UNIGENE: Oar.455

KEGG: oas:443540

Promotions