Home
Product
Protein
Recombinant Proteins
Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial

Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial

CSB-EP706579RMS

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$388

Quantity:

Express system: E.coli

Species: Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ompA

Uniprot NO.

Q52657

Research Area

Microbiology

Species

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Source

E.coli

Expression Region

1734-2021aa

Target Protein Sequence

DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF

Mol. Weight

51.8kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

Why aa 1734-2021 were selected for expression? What is the function of this region of the protein?

Thanks for your inquiry. The region 1734-2021 corresponds to Autotransporter domain which has been purchased by other customers before.
In molecular biology, an autotransporter domain is a structural domain found in some bacterial outer membrane proteins.
The domain is always located at the C-terminal end of the protein and forms a beta-barrel structure.
The barrel is oriented in the membrane such that the N-terminal portion of the protein, termed the passenger domain, is presented on the cell surface.
These proteins are typically virulence factors, associated with infection or virulence in pathogenic bacteria.
Passenger domains structurally characterized to date have been shown to be dominated by a protein fold known as a beta helix, typified by pertactin.
The folding of this domain is thought to be intrinsically linked to its method of outer membrane translocation.
If you have interest in other expression region, please consult with us and we will evaluate if we can provide your specified expression region.

Target Background

Function

Elicits protective immunity.

Subcellular Location

[Outer membrane protein A]: Periplasm.; [120 kDa surface-exposed protein]: Secreted. Cell surface. Note=Surface exposed. This bacterium is covered by a S-layer with hexagonal symmetry.; [32 kDa beta peptide]: Cell outer membrane; Multi-pass membrane protein. Note=The cleaved C-terminal fragment (autotransporter domain) is localized in the outer membrane.

Protein Families

Rickettsiae OmpA/OmpB family

Database Links

KEGG: rco:RC1273

Promotions