Abbreviation
Recombinant Rat Gcgr protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Gcgr at 2 μg/mL can bind Anti-Gcgr recombinant antibody (CSB-RA009316MA1HU). The EC50 is 29.63-35.34 ng/mL.
Alternative Names
Glucagon receptor; GL-R; Gcgr
Species
Rattus norvegicus (Rat)
Expression Region
27-137aa
Target Protein Sequence
AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQSWRDASQCQMDDDEIEVQKGVAK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Gcgr at 2 μg/ml can bind Anti-Gcgr recombinant antibody (CSB-RA009316MA1HU). The EC50 is 29.63-35.34 ng/mL.
Description
Glucagon receptor signaling drives hepatic glucose output and represents a validated target in metabolic disease and certain cancers where aberrant glucagon pathways fuel tumor growth. This mammalian-expressed construct spanning residues 27–137 captures the extracellular ligand-binding domain with native post-translational modifications that preserve conformational epitopes, as demonstrated by its ability to bind an anti-Gcgr recombinant antibody with an EC50 of 29.63–35.34 ng/mL in functional ELISA. The quantified binding kinetics support use in competitive inhibition assays, therapeutic antibody epitope mapping, and small-molecule or biologic inhibitor screening campaigns where accurate receptor-ligand interaction data are essential. Purity exceeding 90% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in SPR, BLI, and cell-based assays requiring low background interference.