Recombinant Rat Beta-nerve growth factor (Ngf), partial

In Stock
Code: CSB-EP015779RA1
Size:
20μg
20μg100μg1mg
US$306
Quantity:
Express system: E.coli
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Rat Ngf protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Target Names
Ngf
Uniprot NO.
Research Area
Others
Alternative Names
Beta-NGF
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
124-241aa
Target Protein Sequence
THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival. The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
Gene References into Functions
  1. proinflammatory cytokines suppressed the TGFbetamediated expression of NGF in PDLderived fibroblasts through the inactivation of TGFbetainduced Smad2/3 and p38 MAPK signaling. PMID:29901090
  2. Impairments in the extracellular maturation of proNGF are sufficient to cause a somatodendritic retrograde degeneration o fdegeneration of basal forebrain cholinergic neurons. PMID:29609077
  3. McGill APP transgenic rats exhibit differential dysregulation in NGF and BDNF neurotrophins. At early stages, intraneuronal Abeta leads to significant reductions in BDNF mRNA expression, which correlate with learning and memory deficits. At later stages, deficits in the NGF metabolic pathway could explain the paradoxical upregulation of proNGF in the absence of changes in NGF mRNA. PMID:28865749
  4. p75NTR is sufficient to mediate the modulation of myogenic cells differentiation by NGF in terms of structural, metabolic and functional changes. PMID:29202822
  5. NGF protects GECs against IND-induced injury. Mitochondria are major targets of both INDO-induced injury and NGF afforded protection of GECs. TrkA expression in the mitochondria of GECs indicates that the protection afforded by NGF is partly mediated by its direct action on mitochondria. NGF prevents MMP depolarization and increases expression of IGF-1 protein in GECs. PMID:28843696
  6. The results suggest that NGF is a prominent hyperalgesic mediator in the trigeminal system and plays a role in trigeminal neuropathic pain PMID:27392124
  7. Early and late behavioral changes in sciatic nerve injury may be modulated by nerve growth factor and substance P in rats PMID:28685530
  8. A higher level of nerve growth factor in the early days post-transvaginal mesh implantation is associated with a shorter voiding interval and a smaller bladder capacity, which represents abnormal lower urinary tract symptoms following transvaginal mesh implantation. PMID:27762470
  9. Findings might aid in identifying effective treatment windows for nerve growth factor (NGF)-based strategies to counteract retinal and/or optic-nerve degeneration. PMID:28067793
  10. The aim of our study was to investigate the influence of two mild stressors, acute and chronic exposure to forced swim (FS) or high-light open field (HL-OF), on neurons containing NGF. PMID:27978417
  11. This work sheds light on the role of miR-132 in bladder overactivity, bladder hypertrophy, NGF signaling and expression of inflammatory mediators. Findings demonstrate that aberrant expression of NGF and miR-132 is involved in voiding dysfunctions. PMID:27789288
  12. Data indicate the effects of vitamin B12 and omega-3 fatty acid supplementation across three consecutive generations on brain neurotrophins like brain derived neurotrophic factor (BDNF); nerve growth factor (NGF) and cognitive performance in the third generation male offspring. PMID:27569259
  13. This study demonstrated that Age-dependent changes in the density of NGF-ir neurons in stressed rats are probably caused by ageing processes and they may point to dysregulation of excitatory control exerted by the amygdala. PMID:26724365
  14. Data indicate that nerve growth factor precursors and nerve growth factor (ProNGF and NGF) and the downstream effector proteins play an important role in the growth, differentiation, and apoptosis of oligodendrocyte (OLG). PMID:26681653
  15. NGF in the facet joint contributes to the development of injury-induced joint pain. Localized blocking of NGF signaling in the joint may provide potential treatment for joint pain. PMID:26521746
  16. This study deminstrated that elevated NGF after peripheral nerve injury induces neurite sprouting and the formation of synapse-like structures within the contralateral DRG, leading to the development of chronic mirror-image pain. PMID:26121254
  17. Results suggest the induction of NGF represents an adaptive response against immune-mediated neuroinflammation in the dorsal root ganglia and spinal cord that likely contributes to the experimental autoimmune encephalomyelitis attenuation PMID:25801841
  18. elevation of plasma norepinephrine in neonatal colonic inflammation induces NGF expression in the gastric fundus. PMID:26608656
  19. NGF acts directly on photoreceptors survival and prevents photoreceptor degeneration. PMID:25897972
  20. Identify nerve growth factor as a binding partner for MOG and demonstrate that this interaction is capable of sequestering NGF from TrkA-expressing neurons to modulate axon growth and survival. PMID:26347141
  21. Let-7 microRNAs regulate peripheral nerve regeneration by targeting nerve growth factor. PMID:25394845
  22. Ginger extract has a synaptogenic effect via NGF-induced ERK/CREB activation, resulting in memory enhancement. PMID:25049196
  23. Chronic heart failure impairs the expression of nerve growth factor in the sympathetic and sensory nerves. PMID:24913185
  24. Vibration significantly increases total-NGF mRNA in interverterbal discs. Protein expression of BDNF increases by nearly 10-fold, especially in the inner annulus fibrosus and nucleus pulposus. PMID:24921856
  25. NGF exhibits anti-oxidative and hepatoprotective effects and is suggested to be therapeutically applicable in treating cholestatic liver diseases. PMID:25397406
  26. Activation of microtubule dynamics increases neuronal growth via the NGF- and Galpha s-mediated signaling pathways. PMID:25691569
  27. NGF was increased 12, 24, and 48 hours in hippocampus after sepsis induction PMID:24978930
  28. Findings revealed that NGF may play a pivotal role of anti-apoptosis in spinal cord neurons through retrograde transport of NF-kappaB in Schwann cells following sciatic nerve injury in rats PMID:24620979
  29. Maternal separation decreased NGF levels in the hippocampus which was reversed with methamphetamine. PMID:24407463
  30. the level of NGF expression did not display a meaningful change throughout the immobilization period PMID:24154957
  31. Spinal nerve afferents are important in sustaining and up-regulating the expression of NGF in the sensory neurons innervating the heart in acute myocardial infarction. PMID:24508054
  32. NGF played an important role in the activation of Akt and subsequent up-regulation of BDNF in the sensory neurons in visceral inflammation such as cystitis. PMID:24303055
  33. The temporal mismatch in behaviour, skin [NGF] and phenotypic changes in sensory nerve fibres indicate that increased [NGF] does not cause hyperalgesia after partial mental nerve injury. PMID:24380503
  34. Using gene expression as a functional read-out, our data demonstrate that the relative availability of NGF and proNGF in vivo might modulate the biological outcome of these ligands. PMID:24713110
  35. The synergistic effects of grafting both NGF and GRGD ligands to PCL-CS scaffolds on the growth and differentiation of PC12 cells provide a new biomaterial for neural tissue engineering. PMID:23468336
  36. Denervation causes age-dependent increases in NGF in the VP, which is a potential mechanism by which the autonomic nervous system may regulate prostate growth and lead to BPH/LUTS PMID:23872662
  37. proBDNF accumulated in the hippocampus of aged rats. PMID:23255148
  38. The effects of acute and chronic administration of branched-chain amino acids on protein levels and mRNA expression of nerve growth factor, was investigated. PMID:23559405
  39. Suggest that nerve growth factor, which is elevated in the failing human heart, causes hypertrophy of neurons in cardiac ganglia. PMID:23959444
  40. Hyperosmolarity induces apoptosis of pHCECs by activating JNK signaling. PMID:24327613
  41. Environmental enrichment improves memory and increases nerve growth factor (NGF) concentration in the dentate gyrus. PMID:23460346
  42. NGF contributes to the repair of nerve tissue and improves pain-related behavior after inferior alveolar nerve injury. PMID:23190308
  43. Long-term casting induced heat hyperalgesia, and up-regulation and phenotypic change of NGF in dorsal root ganglia PMID:23234417
  44. Data indicate that nerve growth factor (NGF) mRNA levels changed significantly during Leydig-cell regeneration in vivo. PMID:23743199
  45. Upregulation of NGF in the amygdala promotes behavior of opioid reward and increases sensitivity to subsequent opioids. PMID:22871918
  46. This study suggests that application of hADSCs with NGF-hydrogel on the CN might be a promising treatment for postprostatectomy ED. PMID:22834730
  47. NGF increased expression of ASIC3 in DRG neurons. PMID:22744968
  48. [REVIEW] Neuropathies and clinical presentations result from disruption of NGF signalling in hereditary sensory autonomic neuropathies (HSAN) type IV and HSAN type V. PMID:23157347
  49. NGF gene expression is elevated during the whole course of cerebral concussion, especially in the early phase. PMID:12857442
  50. There were much more Ngf-immunoreactive nerve cells expressed in the dorsal horn in sciatic nerve cryoneurolysis rats with hyperalgesia. PMID:22580175

Show More

Hide All

Subcellular Location
Secreted. Endosome lumen.
Protein Families
NGF-beta family
Tissue Specificity
Detected in the granule and pyramidal cell layer in the hippocampus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products