Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Calgranulin-B
Migration inhibitory factor-related protein 14
Short name:MRP-14
Short name:p14
Myeloid-related protein 14
S100 calcium-binding protein A9
Species
Rattus norvegicus (Rat)
Expression Region
2-113aa
Target Protein Sequence
AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020642RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a9.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020642RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a9.
Description
Amino acids 2-113 constitute the expression domain of recombinant Rat S100a9. The calculated molecular weight for this S100a9 protein is 29 kDa. This S100a9 protein is produced using e.coli expression system. The S100a9 coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant S100a9 protein in following stages of expression and purification.
The rat protein S100-A9 (S100a9) is a member of the S100 family of calcium-binding proteins. S100a9 often forms a heterodimer with S100a8, and together they constitute the S100A8/A9 complex, also known as calprotectin. This complex plays a role in inflammatory responses and is predominantly expressed in myeloid cells. S100a9 has been associated with various immune-related functions, including the regulation of inflammatory processes, antimicrobial activity, and the modulation of cell migration. Research areas related to S100a9 encompass studies on inflammation, autoimmune diseases, and infectious diseases. Understanding the role of S100a9 in these contexts can provide insights into its contributions to immune responses and potential implications for therapeutic interventions targeting inflammatory conditions.
