AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.5kDa
Protein Length
Partial
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Gene References into Functions
A C57BL/6 mouse line carrying the transthyretin (TTR) Gly83Arg gene mutation was successfully established. This strain of mice can be used for the study of hereditary vitreous amyloidosis.PMID:29360446
Results indicate that TTR stability is important for its recently described functions in assisting Abeta transport at the BBB and at the liver and also in regulating LRP1 levels and activity. TTR stabilization can serve as an avenue to increase both Abeta elimination and LRP1 levels, which in turn will further participate in Abeta clearance.PMID:28570028
This study reports a possible mechanism for Rhabdomyolysis-Induced Acute Kidney Injury and suggests that reductions in TTR could increase the generation of Reactive Oxygen Species and induce apoptosis.PMID:29040977
TTR neuritogenic activity is mediated by the megalin receptor and is lost in megalin-deficient neurons.PMID:27518433
New insights into ghrelin cell physiology, and given the known functions of RBP4 and TTR, support an emerging role for the ghrelin cell in blood glucose handling and metabolism.PMID:23840311
Transthyretin (TTR) deposition in the peripheral nervous system is the hallmark of familial amyloidotic polyneuropathy (FAP).PMID:27568093
TTR mediated transport of thyroxine represents a survival mechanism necessary for the myogenic program.PMID:28075349
provide evidence of a new role of Transthyretin as a transcription inducer of insulin-like growth factor receptor I in central nervous system, unveiling a new role in neuroprotectionPMID:25084758
data also indicate that it is unlikely that the behaviors seen in Ttr(-/-) mice are related to its functionPMID:24956283
Native transthyretin inhibits all preeclampsia-like features in the humanized mouse model.PMID:24035612
Amyloid fibrils formed by a mutant form of TTR, A25T, activate microglia, leading to the secretion of tumor necrosis factor-alpha (TNF-alpha), interleukin-6 (IL-6) and nitric oxide.PMID:24008733
Hsf-1 affects podocyte markers NPHS1, NPHS2 and WT1 in a transgenic mouse model of TTRVal30Met-related amyloidosis.PMID:23829269
Fibroblasts endocytose and degrade transthyretin aggregates in transthyretin-related amyloidosis.PMID:23817086
Increased degradation of 14-3-3zeta in lysosomes in the absence of TTR, increasing autophagy.PMID:23523922
our data demonstrate that the increased expression of Ttr in ob/ob mice does not cause (but rather attenuates) their phenotypic abnormalities.PMID:22849972
TTR has an important and nonredundant role in influencing the development of several organs.PMID:23092911
Results suggest that TTR expressed in pancreatic alpha cells may play important roles in glucose homeostasis via regulating the expression of glucagon.PMID:23108050
TTR binds to Grp78 at the plasma membrane, is internalized into the beta-cell via a clathrin-dependent pathway, and that this internalization is necessary for the effects of TTR on beta-cell function.PMID:22183612
the expression of transthyretin and protein kinase Cgamma were increased in the prefrontal cortex but not in the hippocampus of naltrexone-treated micePMID:21111029
Cerebrospinal fluid transthyretin contributes to control of neuronal cell death, edema and inflammation which influences the survival of endangered neurons in cerebral ischemia.PMID:21044072
Results identify transthyretin and Klotho as physiological targets of amyloid precursor protein that are regulated by soluble APPsbeta independent of developmental APP functions.PMID:20855613
TTR mRNA is dramatically up-regulated in the preimplantation mouse uterus as well as the progesterone-treated ovariectomized mouse uterus.PMID:20188365
Using transthyretin (TTR) KO mice as a model of augmented NPY levels, we showed that this strain has increased NPY content in the bone, further validating the expression of this neuropeptide by bone cells.PMID:19954489
Transthyretin is not required for thyroid hormone access to or distribution within the mouse brain.PMID:12182890
Levels of noradrenaline were significantly increased in the limbic forebrain of TTR-null mice. This report represents the first clear indication that TTR plays a role in behaviour, probably by modulation of the noradrenergic systemPMID:15009661
Mice overexpressing mutant APP have high levels of sAPPalpha & transthyretin & do not develop the tau phosphorylation or neuronal loss characteristic of human AD. Anti-transthyretin antibodies reverse this, showing that transthyretin is neuroprotective.PMID:15342738
Transthyretin is clearly not produced in the brain parenchyma of wild-type mice nor in transgenic mouse models of Alzheimer's disease.PMID:16698124
The effect of chronic ethanol treatment on transthyretin expression was analyzed because gamma-PKC mutants do not develop tolerance to chronic ethanol treatment.PMID:16767509
proliferation and apoptosis in the SVZ neural stem cell niche are differentially affected by the lack of TTR synthesis.PMID:17574756
Our results strongly suggest that TTR plays a critical role in modulating Abeta deposition in vivo.PMID:17596449
the absence of transthyretin does not seem to influence the regulation of lipid and glucose metabolismPMID:17611908
data show that the absence of TTR seems to accelerate the poorer cognitive performance normally associated with agingPMID:17698379
TTR participates in nerve physiology and enhances nerve regenerationPMID:17897357
Lowering TTR levels or interfering with retinol binding protein 4-TTR binding may enhance insulin sensitivity in obesity and type 2 diabetesPMID:18285525
TCDD can induce memory deficits by altering the estrogen pathways and a main route of TTR-mediated retinol transport.PMID:18294692
In mouse DRG, TTR mRNA was localized in the peripheral glial cells.PMID:18406527
Data show that the degree of total and vascular Abeta burdens in the aged Tg2576/TTR(-/-) mice is significantly reduced relative to the age-matched Tg2576/TTR(+/-) mice.PMID:18429966
TTR deposited in peripheral nervous system of familial amyloiditic polyneuropathy should be regarded as having blood or CSF originPMID:18835560
Results suggest that transthyretin is up-regulated by estradiol via a pathway involving estrogen receptors alpha and beta.PMID:19130215
TTR has natural substrates in the nervous systemPMID:19138167
Transthyretin, a gene previously suggested to play a role in the reduction of Alzheimer disease, has been identified as a leftward gene asymmetrically expressed in the brains of adult male mice.PMID:19167467
Axonal retrograde transport is impaired in transthyretin knock-out mice, in addition to neurite outgrowth impairment.PMID:19279259
Using both GFP-based and LacZ-based Cre reporter strains, we demonstrate that in Ttr::Cre transgenics, Cre-mediated recombination occurs throughout the visceral endodermPMID:19415627
he alleged neuroprotective role of TTR in the nervous system should be regarded with caution and should not be generalized to all types of insultsPMID:19595729
rat and murine TTR have a lower intrinsic beta-aggregation propensity and a similar native beta-structure stability compared with human TTR.PMID:19602727
Show
More
Hide
All
Subcellular Location
Secreted.
Protein Families
Transthyretin family
Tissue Specificity
Detected in plasma (at protein level). Detected in liver.