Recombinant Mouse Thioredoxin-interacting protein (Txnip), partial

Code: CSB-EP803849MO1
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Txnip protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Txnip
Uniprot NO.
Research Area
Others
Alternative Names
Vitamin D3 up-regulated protein 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
3-318aa
Target Protein Sequence
MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLEEQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILKVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.0 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1). Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth.
Gene References into Functions
  1. TXNIP facilitates the oxidative stress response in glomerular mesangial cells partially through AMPK pathway. PMID:30142540
  2. Thioredoxin-interacting protein (Txnip) is highly induced in retinal vascular endothelial cells under diabetic conditions. Data (including data from studies using knockout mice) suggest that Txnip in retinal vascular endothelial cells plays role in diabetic retinal angiogenesis via Vegf/Vegfr2 and Akt/mTOR signaling. (Vegfr2 = vascular endothelial growth factor receptor-2) PMID:29203232
  3. These results suggest that mitochondrial ROS-TXNIP/NLRP3/IL-1beta axis activation is responsible for tubular oxidative injury, which can be ameliorated by MitoQ via the inhibition of mtROS overproduction PMID:29475133
  4. crucial role in haematopoietic stem cell aging by inhibiting p38 activity via direct interaction PMID:27929088
  5. Data show that p38MAPK phosphorylation significantly increased in lentivirus vector thioredoxin interacting protein (LV-GFP-TXNIP) cells. PMID:29169415
  6. NLR family, pyrin domain containing 3 protein (NLRP3)-/- mice exhibited less severe non-alcoholic steatohepatitis (NASH) than WT mice, whereas thioredoxin-interacting protein (TXNIP) deficiency enhanced NLRP3 inflammasome. PMID:28499273
  7. TXNIP is a direct substrate of protein kinase B (AKT) and is responsible for mediating AKT-dependent acute glucose influx after growth factor stimulation. PMID:28591573
  8. Our data indicate for the first time that the inflammasome is involved in the inflammatory response and cell death in hypoxia-induced beta cells through the ROS-TXNIP-NLRP3 axis in vitro. This provides new insight into the relationship between hypoxia and inflammation in T2D. PMID:29278702
  9. Here the authors demonstrate that thioredoxin-interacting protein (Txnip), which regulates glucose homeostasis in mammals, binds to fructose transporters and promotes fructose absorption by the small intestine. PMID:27725089
  10. thioredoxin-interacting protein deficiency alleviates diabetic renal lipid accumulation through regulation of Akt/mTOR pathway PMID:27497988
  11. All-trans retinoic acid plays a key role in inhibition of hepatic stellate cell activation via suppressing TXNIP expression, which reduces oxidative stress levels. PMID:28322443
  12. TXNIP-NFYA-SREBP2/miR-33a-AMPKalpha/CROT/CPT1/HADHB pathway is conserved in mouse, rat, and human cardiomyocytes and regulates myocardial beta-oxidation. PMID:27199118
  13. results suggest that melatonin confers protection against Cd-induced liver inflammation and hepatocyte death via inhibition of the TXNIP-NLRP3 inflammasome pathway. PMID:28099758
  14. proteomic and functional analyses demonstrated that Txnip inhibits glucose transport through direct binding to glucose transporter 1 (GLUT1). An ex vivo analysis of perfused hearts further demonstrated that the enhanced functional reserve afforded by deletion of Txnip was associated with myocardial glucose utilization during beta-adrenergic stimulation. PMID:27037370
  15. Thrombin activates reactive oxygen species (ROS)/thioredoxin binding protein (TXNIP)/NLRP3 signaling in BV2 microglia cells, which may indicate a mechanism that pro-inflammatory and pro-apoptotic contributes to the development of intracerebral hemorrhage (ICH). PMID:28202418
  16. TxNIP appears to be an important factor in FFA-induced ROS generation and insulin resistance in skeletal muscle cells PMID:27702549
  17. Glucose exerts strong stimulatory effects on activation histone marks while having inhibitory effects on repression marks in the promoter of the TXNIP gene, and this was associated with a marked increase in expression of the proinflammatory gene in kidney. PMID:26806835
  18. Diabetes induces TXNIP expressions at mRNA levels, but shows the opposite effect on GS. PMID:27131835
  19. ITCH targets TXNIP for ubiquitin-proteasome degradation in cardiomyocytes and ameliorates reactive oxygen species-induced cardiotoxicity through the thioredoxin system. PMID:26796253
  20. Txnip plays an important role in oxidative inflammatory response and atherosclerotic lesion development in ApoE knockout mice. PMID:26062991
  21. The results indicate that a lack of TxNIP protects against diabetic nephropathy (DN) and support in vitro data that upregulation of TxNIP by glucose is a key mediator of early oxidative stress and a trigger for the development and progression of DN. PMID:25855771
  22. Reactive oxygen species regulation through REDD1/TXNIP is physiological rheostat controlling stress-induced autophagy. PMID:25916556
  23. These findings suggest that TXNIP is required for endothelial cell survival and homeostasis especially under stress conditions including hyperoxia. PMID:25329456
  24. HG-induced NADPH oxidase activation is driven by TXNIP which subsequently triggers NALP3 inflammasome activation in podocytes and ultimately led to podocyte injury PMID:25834832
  25. Data indicate that thioredoxin-interacting protein (TXNIP)levels are induced in erythroid differentiation. PMID:25600403
  26. In vivo, levels of lipogenic proteins, inflammatory molecules, PGC-1alpha, and PRMT1 were increased in the livers of HFD mice compared with those fed a chow diet, and were ameliorated in HFD Txnip(-/-) mice. PMID:25003952
  27. we demonstrated that TXNIP-mediated NLRP3 inflammasome activation in cardiac microvascular endothelial cells was a novel mechanism of myocardial ischemia/reperfusion injury PMID:25015733
  28. Genetic deletion of Txnip in cells and mice led to increased protein ubiquitination and splicing of the unfolded protein response regulated transcription factor X-box-binding protein 1 at baseline as well as under endoplasmic reticulum stress. PMID:24843047
  29. results demonstrate that TXNIP binding to NLRP3 is a key signaling mechanism necessary for hHcys-induced NLRP3 inflammasome formation and activation and subsequent glomerular injury. PMID:25138219
  30. TXNIP is a promising new target for the development of new therapies for the treatment of retinal neurodegenerative diseases. PMID:24283717
  31. The TXNIP expression is required for VEGF-mediated VEGFR2 activation and angiogenic response in vivo and in vitro. TXNIP expression regulates VEGFR-2 phosphorylation via S-glutathionylation of LMW-PTP in endothelial cells. PMID:23718729
  32. We demonstrated that TXNIP impairs glucose and insulin tolerance in mice by upregulating G6pc through interaction with small heterodimer partner (SHP). PMID:24037087
  33. studies have identified a novel TXNIP/miR-124a/FoxA2/IAPP signaling cascade linking the critical beta-cell signaling pathways of TXNIP and IAPP PMID:24627476
  34. Data suggest that in vitro fertilization and embryo culture, even under optimal conditions, lead to long-term metabolic alterations; up-regulation of Txnip in offspring may serve as a biological markers for these ill effects. PMID:24684304
  35. TXNIP regulates Src activation via regulation of VE-cadherin-SHP2-Src complex, resulting in altered endothelial cells stress fibers. PMID:24515523
  36. TXNIP is a novel molecule that links NO synthesis and NLRP3 inflammasome activation during endotoxic shock. PMID:24098117
  37. Nuclear factor-kappaB, c-Jun-N-terminal kinase, and signal transducer and activator of transcription 3 were activated much earlier and to a greater extent in Vitamin D3 up-regulated protein 1 knockout mice after partial hepatectomy. PMID:23820201
  38. demonstrated increased expression of TXNIP, LC3/LC3-II and p62 in renal tubular cells in diabetic nephropathy PMID:24492284
  39. Txnip is a critical regulator of glucose metabolism in oocytes and is involved in maintaining cytoplasmic streaming in mouse oocytes. PMID:23976953
  40. These data implicate a critical role for TXNIP in diabetes-related impairment of ischemia-mediated angiogenesis and identify TXNIP as a potential therapeutic target for the vascular complications of diabetes. PMID:24198286
  41. TXNIP is a regulator of p53 and plays a pivotal role in the maintenance of the hematopoietic cells by regulating intracellular ROS during oxidative stress. PMID:23823478
  42. TXNIP controls microRNA expression and insulin production and miR-204 is involved in beta-cell function. PMID:23975026
  43. tnxip is responsible for mediating substrate feedback inhibition and is a potential target for modulating creatine homeostasis PMID:23715727
  44. an overview of TXNIP protein and function PMID:22750447
  45. Suppression of Txnip by lipopolysaccharide is accompanied by a decrease of the glucose sensing transcription factor MondoA in the nuclei. PMID:23520550
  46. Data indicate that Txnip expression is increased in the hypothalamus of Gpr50-/- mice during torpor. PMID:23584857
  47. The effect of hypoxia on TXNIP expression is mediated via the inhibition of the 4E-BP1/eIF4E axis of mechanistic target of rapamycin (mTORC1). PMID:23454121
  48. Upregulation of Trx1 by Na2S therapy in the setting of heart failure sets into motion events which ultimately leads to the attenuationof left-ventricular remodeling. PMID:23349187
  49. VDUP1-deficient mice wereresistant to P. aeruginosa-induced bacteremic shock. It promoted neutrophil recruitment into the peritoneal cavity & impeded the phagocytosis of non-opsonized P. aeruginosa by the PI 3-kinase pathway in macrophages. PMID:23246829
  50. Nrf2 is a key gatekeeper of Txnip transcription, suppressing both its basal expression and MondoA-driven induction to control the thioredoxin redox signaling in diabetes. PMID:22869588

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Arrestin family
Tissue Specificity
Ubiquitously expressed.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products