Recombinant Mouse Resistin (Retn)

Code: CSB-MP019573MO
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: N-terminal hFc1-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Retn protein
Purity
Greater than 95% as determined by SDS-PAGE.
Target Names
Retn
Uniprot NO.
Research Area
Others
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
21-114aa
Target Protein Sequence
SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

This recombinant mouse Resistin comes from a mammalian cell system, which appears to ensure proper folding and post-translational modification. The protein includes the full length of the mature sequence from amino acids 21 to 114. It's tagged with an N-terminal hFc1 for enhanced stability and detection. SDS-PAGE verification shows purity exceeding 95%, making this a reliable reagent for research applications where high-quality protein is essential.

Resistin is a hormone that's primarily involved in metabolic processes. It notably influences glucose metabolism and insulin resistance. This protein belongs to the adipokine family and has been studied extensively for its role in obesity-related research. Resistin likely serves as a key component in regulating inflammation, which may provide valuable insights into metabolic syndrome and cardiovascular research. This makes it an important target for understanding complex metabolic pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mammalian cells provide the appropriate environment for proper folding, disulfide bond formation, and post-translational modifications required for resistin's biological activity. Resistin is known to form disulfide-linked multimers and requires correct oligomerization for its function in metabolic regulation. The hFc tag may enhance solubility and purification but could potentially affect the protein's native oligomerization state or receptor binding. While the mammalian expression system suggests a high probability of correct folding, the protein's bioactivity (e.g., receptor binding ability) remains unknown without experimental validation.

1. Antibody Development and Validation Studies

This application is highly suitable. The mammalian-expressed resistin with hFc1 tag is an excellent immunogen for generating specific antibodies. The Fc tag facilitates purification, and the mammalian system likely preserves native conformational epitopes. Validate resulting antibodies against native mouse resistin from physiological sources to ensure recognition of natural oligomeric forms.

2. Protein-Protein Interaction Studies

The hFc1 tag enables protein A/G-based pull-down assays to study interactions with potential receptors or binding partners. However, the Fc tag itself may cause non-specific binding through Fc receptors. Validate any identified interactions using tag-free resistin or confirm with complementary methods like surface plasmon resonance. First, confirm the protein's receptor-binding capability.

3. ELISA Development and Standardization

This recombinant mouse Resistin is suitable for ELISA development, but with important considerations. The hFc1 tag allows oriented immobilization via anti-Fc antibodies, potentially improving assay sensitivity. However, ensure the detection antibodies target resistin-specific epitopes not blocked by the Fc tag. Validate the assay with native resistin standards to ensure accurate quantification of physiological forms.

4. Biochemical Characterization and Stability Studies

This recombinant mouse Resistin is well-suited for biophysical characterization. The high purity enables accurate analysis of oligomerization state (important for resistin function), thermal stability, and structural properties. However, the hFc tag may influence the observed oligomerization behavior - compare with tag-free resistin when possible.

Final Recommendation & Action Plan

Before using this recombinant resistin for functional studies, validate its bioactivity through receptor binding assays or functional cellular assays (e.g., testing its effect on insulin signaling). Confirm its oligomeric state using size exclusion chromatography with multi-angle light scattering. For antibody production, proceed directly, but validate antibodies against native resistin. For interaction studies, consider cleaving the Fc tag if it interferes with physiological interactions. Always include appropriate controls accounting for the Fc tag's potential non-specific binding.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
Gene References into Functions
  1. Resistin inhibited the activation of CREB, resulting in suppression of PGC-1alpha. Importantly, overexpressing PGC-1alpha can rescue the inhibitory effects of resistin on fatty acid beta oxidation. PMID:29730652
  2. Resistin-associated VSMC dysfunction and intimal hyperplasia are related to PKCepsilon-dependent Nox activation and ROS generation PMID:27573736
  3. OLI is a physiological repressor of systemic resistin release whereas FFA upregulate resistin release in vitro from adipocytes. PMID:26285069
  4. Resistin possibly acts via an intracrine pathway as an intracellular sensor, regulating the adipocyte insulin sensitivity. PMID:26036220
  5. Mouse Resistin has regulative effects on murine bone marrow hematopoiesis. PMID:26572487
  6. murine resistin is increased in the lungs of wild-type mice following acute ozone exposure but does not promote ozone-induced lung pathology. PMID:26386120
  7. Inhibition of miR-696 restored the triglycerides content by up to 80%, which suggests that, in C2C12 cells, resistin at least partially increases the deposition of lipids through miR-696. PMID:25962325
  8. Antiresistin RNA oligo ameliorated metabolic abnormalities and histopathology of nonalcoholic fatty liver disease through attenuating proinflammatory cytokines PMID:25922835
  9. Resistin regulates PAI-1 expression in 3T3-L1 adipocytes via Akt phosphorylation. PMID:24667608
  10. Oxidized-LDL promotes the expression and secretion of visfatin and resistin through its activation of endoplasmic reticulum stress. PMID:24278099
  11. ET type-A receptor, ERK1/2, JNKs, AKT, and JAK2, but not ET type-B receptor or p38, are necessary for the ET-1 stimulation of resistin gene expression PMID:24424064
  12. resistin is a negative regulator of SIRT1 in both human hepatoma cell line HepG2 and mouse hepatocytes. PMID:23827175
  13. Both resistin gene expression and its secretion from the epididymal adipose tissue were decreased in db/db obese mice, while the insulin-sensitizing drug rosiglitazone increased resistin production. PMID:23776497
  14. lipid content was significantly decreased in 3T3-L1 cells transfected with anti-resistin small interfering RNA (siRNA) after adipocyte differentiation PMID:24034627
  15. The effect between resistin and adiponectin on the proliferation of vascular smooth muscle cells (VSMCs), was investigated. PMID:23267839
  16. The current study was initiated to determine whether resistin has additional roles in glucose-dependent insulinotropic polypeptide -regulated adipocyte functions. PMID:23002036
  17. significant changes in fasting-induced adipose factor (FIAF), resistin (Rstn), long-form leptin receptor (LepRb) and suppressor of cytokine-3 (SOCS3) gene expression following chronic SCI and with advanced age PMID:22815920
  18. results identify resistin as a potential inhibitory ligand for the receptor ROR1 and demonstrate, for the first time, that ROR1 plays an important role in adipogenesis and glucose homeostasis in 3T3-L1 cellsand glucose homeostasis in 3T3-L1 cells. PMID:22074948
  19. Cleavage product of decorin serves as a functional receptor of resistin in adipocyte progenitors and may regulate white adipose tissue expansion. PMID:21683670
  20. review of evidence that resistin (secreted by adipocytes in the mouse) is an inflammatory biomarker and a potential mediator of obesity, diabetes and cardiovascular disease [REVIEW] PMID:21497511
  21. Valsartan did not alter resistin expression in the ob/ob mouse. PMID:20472602
  22. Data suggest that s-resistin isoform may play a role in inflammatory processes. PMID:20627112
  23. data suggest that endogenous resistin might be capable of fine-tuning the expression and enzymatic activity of various hypothalamic targets previously implicated in the delicate homeostatic control of food intake PMID:19646421
  24. Tumor necrosis factor alpha is a negative regulator of resistin gene expression and secretion in 3T3-L1 adipocytes PMID:11689013
  25. Mechanisms regulating adipocyte expression of resistin PMID:11901161
  26. examined the effect on resistin expression of various hormones and cytokines known to affect insulin sensitivity. PMID:12031960
  27. Data demonstrate that basal and hormonal stimulation of resistin secretion by insulin is inhibited by ET-1. PMID:12163029
  28. results indicate that the substantial reduction of adiposity in lactation does not lead to any changes in resistin gene expression in white adipose tissue PMID:12163041
  29. expression and regulation in mouse pituitary; data suggest that local resistin expression could have functional implications during prepubertal maturation of the hypothalamic-pituitary system PMID:12208498
  30. during in vivo bone formation and remodeling, probably acting as a co-factor or accessory protein that modulates the effects of primary signaling molecules PMID:12413946
  31. Resistin expression is regulated by C-EBP Proteins, peroxisome proliferator-activated receptor, and signal-transducing molecules. PMID:12437985
  32. Resistin is regulated and expressed in mouse brown adipocytes PMID:12482590
  33. resistin does not alter insulin receptor signaling but does affect insulin-stimulated glucose uptake, presumably by decreasing the intrinsic activity of cell surface glucose transporters PMID:12618360
  34. ADSF/resistin secretion controls fat cell differentiation and adipose tissue development. PMID:12660879
  35. Despite severe weight loss and significant falls in leptin expression and insulin concentration, resistin gene expression appears unchanged in white adipose tissue of mice with MAC16 tumour. PMID:12660881
  36. Data show that neuropeptie Y significantly increased resistin mRNA expression in white adipose tissue compared with artificial cerebrospinal fluid treated controls. PMID:12684710
  37. resistin is a novel secreted factor first identified as a TZD-suppressible gene PMID:12700889
  38. results demonstrate that leptin decreases resistin expression and suggest that resistin may influence glucose homeostasis PMID:14962997
  39. mice lacking resistin exhibit low blood glucose levels after fasting, due to reduced hepatic glucose production; data support a physiological function for resistin in the maintenance of blood glucose during fasting PMID:14976316
  40. Inhibits insulin-stimulaed glucose uptake into skeletal muscle cells without affecting insulin signaling pathways. Review. PMID:15055467
  41. demonstrates in vivo the inhibitory role of ADSF in adipogenesis PMID:15090646
  42. Pituitary resistin expression is age- and gender-dependent. In ob/ob and fasted mice, resistin is regulated in a tissue-specific manner. Visceral fat obesity increases but starvation decreases resistin mRNA. PMID:15103228
  43. Plasma resistin of leptin-treated mice was barely decreased. PMID:15126241
  44. Chronic hyperresistinemia impairs normal glucose metabolism. PMID:15189975
  45. Nutritional regulation of resistin and changes in resistin gene expression and circulating levels in obesity are mediated, at least in part, through insulin and glucose. PMID:15220189
  46. results indicate that chronic "hyper-resistinemia" leads to whole-body insulin resistance involving impaired insulin signaling in skeletal muscle, liver, and adipose tissue, resulting in glucose intolerance, hyperinsulinemia, and hypertriglyceridemia PMID:15254589
  47. These results provide strong support for a physiological role of resistin in the development of hepatic insulin resistance. PMID:15254590
  48. Article reviews recent studies of Resistin/ADSF/FIZZ3 in transgenic and knockout mice. PMID:15358276
  49. Resistin overexpression induces dyslipidemia in mice, which is commonly seen in the insulin-resistant state, partially through enhanced secretion of lipoproteins. PMID:15471967
  50. gender differences in resistin, adiponectin and leptin mRNA expression and plasma levels were not ablated by castration and seem to be dependent on other factors in addition to gonadal steroids PMID:15483213

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Resistin/FIZZ family
Tissue Specificity
Expressed in white but not brown adipose tissue in a variety of organs.
Database Links

UNIGENE: Mm.1181

KEGG: mmu:57264

STRING: 10090.ENSMUSP00000012849

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products