Recombinant Mouse Probetacellulin (Btc), partial

Code: CSB-EP002853MO

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$256

Quantity:

Express system: E.coli

Species: Mus musculus (Mouse)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Mouse Btc protein, partial

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Btc

Uniprot NO.

Q05928

Research Area

Others

Alternative Names

Btc

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

32-111aa

Target Protein Sequence

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

16.0 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Gene References into Functions

Betacellulin promotes the proliferation of corneal epithelial stem cells through the phosphorylation of Erk1/Erk2. PMID:29331377
The results of this study suggested a novel regulatory role of Btc in axon-Schwann cell interactions involved in myelin formation and nerve repair. PMID:28139851
BTC induces expansion of neural stem cells and neuroblasts, and promotes neurogenesis in the olfactory bulb and dentate gyrus. PMID:22232668
Betacellulin exerts proliferative activity on beta cells through the activation of ErbB-1 and ErbB-2 receptors PMID:21897861
BTC overexpression enhances glucose-induced insulin secretion in Mesenchyma Stem Cells PMID:20836700
Betacellulin protects from pancreatitis by activating stress-activated protein kinase. PMID:20038432
Excess of betacellulin exerts no deleterious effects on the structure or function of the male reproductive tract in mice. PMID:19931240
structure of the BTC gene PMID:12031500
Defective valvulogenesis in HB-EGF and TACE-null mice is associated with aberrant BMP signaling. PMID:12773386
Mice overexpressing BTC exhibit high early postnatal mortality, reduced body weight gain, impaired longitudinal growth, cataract, retinal and bone abnormalities, and lung disease. PMID:16179416
identified hitherto unknown effects of betacellulin (BTC) overabundance in reproduction and suggests BTC as a novel candidate protein for the modulation of fertility. PMID:17914071
role of BTC in the regulation of epidermal homeostasis, hair follicle morphogenesis and cycling, and wound angiogenesis PMID:17960175
Overexpression of BTC results in an EGFR-dependent upregulation of cortical bone mass in the appendicular skeleton of mice. PMID:19049329
Long-term BTC overabundance does not alter pancreatic islet structure and beta-cell mass, but enhances glucose-induced insulin secretion in vivo as well as in vitro. PMID:19100309
Reversal of streptozotocin-induced hyperglycemia by continouous supply of Btc. PMID:19378417

Hide All

Subcellular Location

[Betacellulin]: Secreted, extracellular space.; [Probetacellulin]: Cell membrane; Single-pass type I membrane protein.

Tissue Specificity

Found in several mouse tissues including kidney, uterus and liver, as well as in beta tumor cell line and MCF-7 cells. It is not detected in the brain.

Database Links

UNIGENE: Mm.2024

KEGG: mmu:12223

STRING: 10090.ENSMUSP00000112765

Promotions