AVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.1 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).
Gene References into Functions
The abnormal social behaviors of Dio3-/- mice were associated with sexually dimorphic alterations in the physiology of oxytocin (OXT) and arginine vasopressin (AVP), 2 neuropeptides with important roles in determining social interactions.PMID:28715127
Data indicate that oxytocin participates in the spine remodeling, synaptic refinement, and social stimuli-dependent plasticity in the posterodorsal medial amygdala of male mice.PMID:28889007
Activation of the oxytocin receptor in brain regions facilitates social defeat posture.PMID:29186377
the absence of OT leads to significant changes in the expression of the studied genes (OTR, ERalpha, ERbeta, V1aR), and these changes may contribute to the decreased sexual behavior observed in OT gene knockout females.PMID:27558735
These results reveal that Oxt protects pancreatic beta cells against death caused by metabolic stress, and Oxt signaling may be a potential therapeutic target.PMID:27143105
CA3 pyramidal cells in the adult mouse hippocampus express OXT receptors and receive inputs from hypothalamic OXT neurons.PMID:28912554
These results identify G9a-induced histone methylation at the OXT and AVP promoters in the Basolateral Amygdala as a mechanism for mediating stress-induced lasting behavioral depression and its reversal by exercise.PMID:25863961
Data indicate that oxytocin is an important synaptic modulator in the posterodorsal medial amygdala, a finding that is likely involved with the display of the female sexual behavior.PMID:26163772
OXT was up-regulated in both hypothalamic magnocellular neurosecretory cells and parvocellular cells by chronic inflammation, and also that OXT in the PVN-spinal pathway may be involved in sensory modulationPMID:25943916
role for a neuronal population in the control of maternal care and oxytocin secretion; and evidence for a causal relationship between sexual dimorphism in the adult brain and sex differences in parental behaviourPMID:26375004
Oxtr signaling is crucial for entrainment of odor to social cues but is dispensable for entrainment to nonsocial cues. Oxt conveys saliency of social stimuli to sensory representations in the piriform cortex during odor-driven social learning.PMID:26139372
Oxytocin is is required for proper muscle tissue regeneration and homeostasis, and that plasma levels of oxytocin decline with age. Genetic lack of oxytocin does not cause a developmental defect in muscle but instead leads to premature sarcopenia.PMID:24915299
results describe fundamental synaptic mechanisms by which oxytocin increases the salience of acoustic social stimuli; furthermore, oxytocin-induced plasticity provides a biological basis for lateralization of auditory cortical processingPMID:25874674
Results show that OT inhibits appetite for carbohydrates; sucrose consumption considerably enhances OT gene expression and is particularly sensitive to OT receptor blockadePMID:24893201
Data suggest that oxytocin plays a crucial role in the sexual behavior display, number of released oocytes and density of dendritic spines in the MePD of female mice without affecting AVP plasma concentrationPMID:23906766
lactic acid microbes accelerate wound healing via the neuropeptide hormone oxytocinPMID:24205344
CD38 in the nucleus accumbens and oxytocin are critical in paternal behavior.PMID:24059452
A new form of plasticity is identified in neonatal mice, when early sensory experience cross-modally regulates development of all sensory cortices via oxytocin signaling.PMID:24464043
the rewarding properties of social interaction in mice require the coordinated activity of oxytocin and 5-HT in the nucleus accumbens--with implications for understanding the pathogenesis of social dysfunction in neuropsychiatric disorders like autismPMID:24025838
data suggest that OT modulates social investigation behavior and the aggressiveness of male mice. TPMID:23376700
Oxytocin pathways may not be essential for regulating voluntary sodium ingestion.PMID:22784207
medial amygdala likely modulates hostile aggressive behavior associated with immediate early gene expression in OXT and vasopressin neuronsPMID:23403283
these results support the hypothesis that the expression of the mouse oxytocin receptor gene is epigenetically regulated by DNA methylation of its promoter.PMID:23441222
We conclude that Maged1 is required for oxytocin processing or stability. A decrease in mature OT levels in Maged1 mutants affects social interactions and possibly other behavioral processesPMID:22865874
OT release in bone marrow by a rising estrogen concentration may facilitate rapid skeletal recovery during the latter phases of lactation.PMID:22761429
We consider hypotheses of the roles played by central and systemic OT release as well as their control and modulation in the female in mating and pregnancy--REVIEWPMID:22107910
we describe data detailing the molecular mechanism of CD38-dependent OXT secretion in CD38 knockout mice--REVIEWPMID:22227279
results support the idea that variation in ovarian hormones could be related to individual differences in social recognition, at least partly through modulation of the OT and/or AVP systems, particularly in the DS, LA and MPOA.PMID:22079582
The data suggested that vasopressin or oxytocin exert a minimal effect on most GABA neurons in the lateral hypothalamus but exert a robust excitatory effect on presumptive GABA cells that contain melanin-concentrating hormone.PMID:22262306
there is a local feed-forward loop in bone marrow through which the OT so produced from osteoblasts in response to estrogen acts upon its receptor to exert a potent anabolic action.PMID:21741363
Oxytocin plays a pivotal role in mediating the adaptation mechanism following chronic homotypic stress in mice.PMID:21439349
Fto, a proposed transcription co-factor, influences expression of the gene encoding a satiety mediator, oxytocin.PMID:21514276
Recently a new tool has been created that has furthered our understanding of oxytocin's role in behavior: transgenic mice that lack either the ability to synthesize oxytocin or the oxytocin receptor itself--REVIEWPMID:20732312
global reduction in FGF8 signaling leads to an overall reduction of mature OT and oxyphysin prohormone levels that may have resulted from defects in multiple stages of the hormone-synthesis pathwayPMID:21046478
central oxytocin plays a pivotal role in mediating the adaptation mechanism following repeated restraint stress in micePMID:20969650
Oxytocin acts as a carbohydrate-specific inhibitor of feeding.PMID:20685878
OXT elicits Ca2+ signals via OXTR in murine taste budsPMID:20700536
Data show that EBs expressed Oct-4, OTR, OT, and DAZL.PMID:19695304
The upregulation of central oxytocin expression is involved in mediating the adaptation mechanism following chronic repeated stress in mice.PMID:19889866
The OT/OTR system plays an important role in cardiogenesis by promoting cardiomyocyte differentiation.PMID:12093924
Results suggest that estrogen receptor-beta activation may play a critical role in estrogenic regulation of oxytocin and arginine vasopressin gene expression in the paraventricular nucleus.PMID:12531518
OT is 1)involved in tonic blood pressure maintenance; 2)extends the functional range of arterial baroreceptor reflex; 3)reduces the sympathetic reservePMID:12531722
required for mammalian social recognition, through which an individual learns to recognize other individualsPMID:12730370
that OT pathways play a role in modulating anxiety in female mice of the C57BL/6 background, and the effect is mediated by the OT receptor.PMID:12746288
oestrogen-dependent regulation of oxytocin and vasopressin synthesis in the paraventricular hypothalamic nucleus is mediated by ERbeta.PMID:12834440
Blood oxytocin concentrations on d 9 postpartum were also lower in Usf2-/- mice than Usf2+/+ micePMID:12907752
Regulatory element in the intergenic region of the oxytocin gene controls hypothalamus-specific expression.PMID:12944509
Oxytocin plays a role in the regulation of blood pressure and salt appetite.PMID:12953013
OT signaling pathways are unnecessary for the anorexigenic effects of systemically administered CCK and d-fenfluramine in C57BL/6 mice.PMID:14557235