Recombinant Mouse Nuclear factor NF-kappa-B p105 subunit (Nfkb1), partial

Code: CSB-EP015759MO
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Nfkb1 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Nfkb1
Uniprot NO.
Research Area
Others
Alternative Names
DNA-binding factor KBF1;EBP-1;NF-kappa-B1 p84/NF-kappa-B1 p98;Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-431aa
Target Protein Sequence
MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.9 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and RelB-p50 complexes are transcriptional activators. The NF-kappa-B p50-p50 homodimer is a transcriptional repressor, but can act as a transcriptional activator when associated with BCL3. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. The proteasome-mediated process ensures the production of both p50 and p105 and preserves their independent function, although processing of NFKB1/p105 also appears to occur post-translationally. p50 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. Plays a role in the regulation of apoptosis. Isoform 5, isoform 6 and isoform 7 act as inhibitors of transactivation of p50 NF-kappa-B subunit, probably by sequestering it in the cytoplasm. Isoform 3 (p98) (but not p84 or p105) acts as a transactivator of NF-kappa-B-regulated gene expression. In a complex with MAP3K8, NFKB1/p105 represses MAP3K8-induced MAPK signaling; active MAP3K8 is released by proteasome-dependent degradation of NFKB1/p105.
Gene References into Functions
  1. Reducing NF-kappaB activation attenuates PDLIM2 deficiency-exacerbated inflammation and dyslipidemia in Palmitate -treated primary hepatocytes. PMID:29852170
  2. Chandipura virus infection triggered the activation of signalling pathways mediated by mitogen-activated protein kinases, including p38, JNK 1 and 2, and nuclear factor kappaB. PMID:30001342
  3. These findings provide mechanistic insight into how polymorphisms that attenuate NFKB1 expression predispose humans to epithelial cancers, highlighting the pro-tumorigenic activity of STAT1 and identifying targetable vulnerabilities in GC. PMID:29562203
  4. SIRT1 upregulation protects against liver injury induced by a HFD through inhibiting CD36 and the NF-kappaB pathway in mouse Kupffer cells. PMID:29845302
  5. activation of NF-kappaB pathway is essential for Bacterial lipoprotein tolerance-augmented antimicrobial activity in innate phagocytes and depends primarily on both NOD1 and NOD2. PMID:28079153
  6. High host NF-kappaB p50 induces murine glioblastoma tumor. PMID:30030559
  7. NF-kappaB is responsible for Morgana dependent metastasis. PMID:29158506
  8. study indicates that downregulation of NF-kappaB1 can suppress renal cell carcinoma tumorigenesis by inducing late apoptosis/necrosis PMID:29212573
  9. TNF-alpha is involved in cardiac PHLPP1 upregulation during reoxygenation, which is mediated by NF-kappaB transcriptional activity PMID:29940243
  10. Nuclear Factor kappa B (NF-kappaB) pathway in the bone marrow (BM) vascular niche is a critical signalling axis that regulates haematopoietic stem cells (HSCs) function. PMID:28000664
  11. NF-kappaB and survivin are coordinately up-regulated in GBM patient tumors, and functional inhibition of either protein or BRD4 in in vitro and in vivo models restores sensitivity to EGFR tyrosine kinase inhibitors PMID:28724615
  12. NF-kappaB1 phosphorylation is regulated by platelet-activating factor in macrophages. PMID:27554194
  13. Blockade of CD38 diminishes lipopolysaccharide-induced macrophage classical activation and acute kidney injury involving NF-kappaB signaling suppression. PMID:29080804
  14. NF-kappaBmiR15abFGF/VEGFA axis contributes to the impaired angiogenic capacity of bone marrowmesenchymal stem cells in high fat dietfed mice. PMID:28944834
  15. Tyr42 phosphorylation of RhoA GTPase promotes tumorigenesis through NF-kappaB. PMID:28712859
  16. By modulating the translation of IkappaBalpha via the Mnk2-eIF4E pathway, Brd4 provides an additional layer of control for NF-kappaB-dependent inflammatory gene expression and inflammatory response. PMID:28461486
  17. BCA3 interacts with Rac1 and augments NF-kappaB signaling in vitro, but has no effect on RANKL-induced bone resorption in vivo. PMID:28791343
  18. TLR4-NF-kappaB signaling pathway was involved in the lipopolysaccharide-induced acute lung injury. PMID:28886315
  19. This is the first report demonstrating that NF-kappaB signaling may play a key role in compensatory lung growth (CLG). Given its pathway is crucial in tissue regeneration of various organs, NF-kappaB may shed light on identification of molecular triggers or clinically usable key regulators of CLG. PMID:28679393
  20. Abrogating ClC-3 blunts lipopolysaccharide-induced Inflammation via blocking the TLR4/NF-kappaB pathway. PMID:27363391
  21. miR-17 approximately 92 family clusters have a role in iNKT cell ontogenesis via modulation of TGF-beta signaling PMID:27930306
  22. NF-kappaB1-mediated signaling regulates the development of gastric mucosal pathology following TAM administration. PMID:28726772
  23. that TG2 depletion increases nuclear factor-kappaB (NF-kappaB) signaling PMID:28522262
  24. LRRK1 physically interacted and potently synergized with CARMA1 to enhance NF-kappaB activation. PMID:27166870
  25. NLRC5 knockout mice fed with high fat showed accelerated fibrosis and inflammation response by promoting alpha-SMA, Collagen I, Collagen III, TLR4/MyD88, phosphorylated IKKalpha, IkappaBalpha and NF-kappaB expression. PMID:28499247
  26. Our data suggest that rCC16 suppresses LPS-mediated inflammatory mediator TNF-alpha, IL-6, and IL-8 production by inactivating NF-kappaB and p38 MAPK but not AP-1 in RAW264.7 cells. PMID:28338974
  27. Our data indicate for the first time that the inflammasome is involved in the inflammatory response and cell death in hypoxia-induced beta cells through the ROS-TXNIP-NLRP3 axis in vitro. This provides new insight into the relationship between hypoxia and inflammation in T2D. PMID:29278702
  28. Overall, these results suggest that p53 is involved in improving insulin sensitivity of hepatic cells via inhibition of mitogen-activated protein kinases (MAPKs) and NF-kappaB pathways. PMID:29258820
  29. In conclusion, the results suggest that linarin has anti-osteoclastic effects and may serve as potential modulatory agents for the prevention and treatment of bone loss-associated diseases. PMID:29269297
  30. The combination therapy of DANFIN with bortezomib dramatically enhanced the apoptosis of multiple myeloma cells and indicated a remarkable anti-tumor effect in a multiple-myeloma xenograft mouse model. PMID:29284118
  31. A new mouse modelof CLL was created by crossing the Emicro-TCL1 mouse with the previously described p50 knockout mouse4 to study the role of p50 in CLL pathogenesis. The knockout animals had lower leukocyte counts and less disease burden than the wild type, implying a role for p50 in CLL. PMID:28515090
  32. Results suggest that insufficient hepatocyte growth factor activator inhibitor type 1 (HAI-1) function promotes intestinal carcinogenesis by activating nuclear factor-kappaB (NF-kappaB) signaling. PMID:27612426
  33. UVB-irradiated or aged mice skin revealed that mTORC2 activity was significantly upregulated which in turn increased Akt activation and Akt-dependent IkappaB kinase alpha (IKKalpha) phosphorylation, and The increased mTORC2 signaling pathway during skin aging were associated to NF-kappaB activation. PMID:27486771
  34. activation of the NF-kappaB pathway through TNF plays an important role in the dedifferentiation of astrocytes via the re-expression of Oct4. PMID:26381429
  35. The constitutive elevations of Prdx6 and NF-kappaB during Clonorchis sinensis infection may be associated with more severe persistent hepatobiliary abnormalities mediated by clonorchiasis. PMID:27554973
  36. SPAK plays a pathogenic role in IgA nephropathy through the activation of NF-kappaB/MAPK signaling pathway. PMID:27519267
  37. Identification of a PPAR-gamma --> NF-kappaB --> p22phox neuroprotective signaling cascade opens a new avenue for protecting the brain against ischemic insult. PMID:26108185
  38. interactions of NF-kappaB and N-myc with GLT-1/EAAT2 promoter sequences was significantly elevated in the ipsi-lateral cortex of both adult and old Traumatic brain injury mice. PMID:26081154
  39. Data show that inhibition of the protease activity of MALT1 might be a strategy to treat inflammatory bowel disease and the NLRP3 inflammasome and NF-kappaB activation are critical components in MALT1 signaling cascades in this disease model. PMID:27105502
  40. IFN-gamma/TNFalpha trigger the formation of an NF-kappaB/STAT3 complex. PMID:28264935
  41. Importantly, inhibition of NF-kappaB by QDs displayed promising effects against the viral replication and in vivo bacterial endotoxin-induced inflammatory responses. These data suggest the QDs as potent inhibitors of the NF-kappaB signaling pathway, both in vitro and in vivo. PMID:27639114
  42. NF-kB mediated upregulation of CADM1 was identified as a mechanism of TNFalpha induced migration. PMID:26867147
  43. NF-kappaB activation and the downstream expression of inflammatory factors were therefore down-regulated in along an efficient path and ameliorating the damage as a consequence of LPS-induced acute lung injury. PMID:28778458
  44. FSTL1 is a secreted osteoclastogenic factor that plays a critical role in osteoclast formation via the NF-kappaB and MAPKs signaling pathways. PMID:27234130
  45. Sustained NF-kappaB inhibition improves insulin sensitivity but is detrimental to muscle health. PMID:28556540
  46. Prostaglandin E receptor subtype 2 (EP2; Ptger2) deficiency suppressed nuclear factor kappaB (NF-kappaB) activation in intracranial arteries 4 and 8 weeks after intracranial aneurysm induction. PMID:28174280
  47. Loss of HDAC-mediated repression and gain of NF-kappaB activation underlie cytokine induction in ARID1A- and PIK3CA-mutation-driven ovarian cancer. PMID:27681437
  48. Absence of Musashi2 in osteoclast precursors promotes apoptosis and inhibits RANKL-induced NF-kappaB activation, which is essential for osteoclast survival. PMID:27441652
  49. Study demonstrated that activation of NF-kB in astrocytes contributes not only to white matter demyelination and axonal loss during chronic hypoxia but that an astrocytic pro-inflammatory pathway may have important consequences for cognitive outcome in neurodegenerative disease. PMID:27487766
  50. NF-kappaB-mediated miR-130a modulation is critical in lung vascular remodeling. PMID:28755990

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Note=Nuclear, but also found in the cytoplasm in an inactive form complexed to an inhibitor (I-kappa-B).; [Isoform 5]: Cytoplasm.; [Isoform 6]: Nucleus. Cytoplasm.; [Isoform 7]: Nucleus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products