Recombinant Mouse NAD-dependent protein deacylase sirtuin-5, mitochondrial (Sirt5)

In Stock
Code: CSB-BP814306MO
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$528
Quantity:
Express system: Baculovirus
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Sirt5
Uniprot NO.
Research Area
others
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
37-310aa
Target Protein Sequence
SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Recombinant Mouse NAD-dependent protein deacylase sirtuin-5 (Sirt5) is produced using a baculovirus expression system. The construct contains the full-length mature protein sequence (37-310aa). To help with purification and detection, this protein carries both an N-terminal 10xHis tag and a C-terminal Myc tag. SDS-PAGE analysis confirms the product achieves greater than 85% purity, which should provide reliable results for research work.

Sirt5 appears to be a mitochondrial protein that may regulate several metabolic processes through its NAD-dependent deacylase activity. The protein's main function seems to involve removing acyl groups from lysine residues on target proteins—a process that likely influences cellular metabolism and energy production. Given its apparent role in mitochondrial function and cellular homeostasis, Sirt5 has become an important research focus, though some aspects of its regulatory mechanisms remain unclear.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Sirt5 is a mitochondrial NAD+-dependent deacylase that requires precise folding, proper cofactor binding (NAD+), and correct subcellular targeting for its enzymatic activity. The baculovirus-insect cell expression system provides a eukaryotic environment that supports proper protein folding, post-translational modifications, and disulfide bond formation, significantly increasing the probability of correct folding. However, as a mitochondrial protein, Sirt5 may require mitochondrial-specific chaperones or processing for full functional activity, which might not be fully replicated in the insect cell system. The dual N-terminal 10xHis-tag and C-terminal Myc-tag are relatively small but may potentially interfere with the protein's mitochondrial targeting or functional domains. While the baculovirus system offers favorable folding conditions, experimental validation remains essential to confirm functional deacylase activity.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

This application's reliability depends on proper folding and functional validation. Sirt5 interactions with mitochondrial proteins or metabolic enzymes require precise tertiary structure and enzymatic competence. If correctly folded and active (verified), the protein is highly suitable for identifying physiological interaction partners in mitochondrial deacylation pathways. If misfolded/inactive (unverified), there is a high risk of non-specific binding or failure to identify genuine interactions, making results biologically misleading.

2. Antibody Development and Validation

Antibody development primarily relies on antigenic sequence recognition. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies that recognize native Sirt5 epitopes. If misfolded/unverified, it remains highly suitable for producing antibodies against linear epitopes, which are still valuable for detection applications in Western blot or immunoassays.

3. Biochemical Characterization and Substrate Screening

These studies are essential for determining folding status and functional competence. If correctly folded and active (verified), characterization provides reliable data on deacylase activity, substrate specificity, kinetic parameters, and cofactor requirements. If misfolded/inactive (unverified), biochemical assays will yield negative or misleading results, though basic physical properties can still be characterized.

4. Protein Stability and Folding Studies

These studies are critical for assessing protein quality regardless of functional state. If correctly folded (verified), analysis provides insights into structural stability and functional requirements. If misfolded/unverified, characterization yields valuable physical property data for this specific preparation and informs handling protocols.

Final Recommendation & Action Plan

The baculovirus expression system provides a favorable eukaryotic environment for this mitochondrial deacylase, but experimental validation of structural integrity and enzymatic activity is essential before reliable use in functional studies. Begin with Applications 3 and 4 (Biochemical Characterization and Stability Studies) to assess folding quality through size-exclusion chromatography, circular dichroism spectroscopy, and validate deacylase activity using NAD+ and known acylated substrates (e.g., succinyllysine or malonyllysine peptides). Once correct folding and functional activity are verified, proceed cautiously with Application 1 for interaction studies, ensuring appropriate controls are included. Application 2 (antibody development) can proceed immediately regardless of folding status. If misfolding or lack of enzymatic activity is detected, limit applications to linear epitope antibody production and basic biophysical characterization, avoiding all functional interaction and substrate screening studies. For reliable Sirt5 research, always include appropriate activity controls using validated deacylation assays and consider the protein's mitochondrial context in experimental design.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species. Activates SHMT2 by mediating its desuccinylation. Modulates ketogenesis through the desuccinylation and activation of HMGCS2. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as Uox.
Gene References into Functions
  1. Data indicate that sirtuin 5 (SIRT5) is an important mitochondrial enzyme for protection against metabolic and ischemic stress following protein kinase C epsilon (PKCepsilon) activation in the brain. PMID:27435822
  2. findings reveal a key role for SIRT5 in maintaining cardiac oxidative metabolism under pressure overload to ensure survival PMID:28972174
  3. Deletion of Sirt5 in starved mouse embryonic fibroblasts increased levels of mitochondrial dynamics leading to mitochondrial accumulation of the pro-fission Drp1 and to mitochondrial fragmentation. PMID:28340937
  4. Our study uncovers a SIRT5-dependent mechanism that regulates cellular NADPH homeostasis and redox potential by promoting IDH2 desuccinylation and G6PD deglutarylation. PMID:27113762
  5. Data (including data from studies using knockout mice) suggest that SIRT5 is targeted to protein complexes on the inner mitochondrial membrane via affinity for cardiolipin to promote respiratory chain function, particularly Complex I and Complex II; SIRT5 expression is observed in inner mitochondrial membrane of periportal hepatocytes. PMID:28458255
  6. Data show that peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1alpha) overexpression significantly increased the expression of sirtuin 3 (SIRT3) and sirtuin 5 (SIRT5). PMID:27052737
  7. In the cochlea, the expression of SIRT1, 3, and 5 (both mRNA and protein) was decreased in the old mice PMID:26472659
  8. These findings establish that regulating heart metabolism and function is a major physiological function of lysine succinylation and SIRT5. PMID:27051063
  9. SIRT5 has a role in cellular metabolism with a multiple enzymatic activities PMID:26208827
  10. SIRT3 and SIRT5 regulate the enzyme activity and cardiolipin binding of very long-chain acyl-CoA dehydrogenase PMID:25811481
  11. Pathway analysis identified glycolysis as the top SIRT5-regulated pathway. Importantly, glycolytic flux was diminished in primary hepatocytes from Sirt5(-/-) compared to WT mice. PMID:26073543
  12. Data indicated that SIRT5 ameliorates MPTP-induced nigrostriatal dopaminergic degeneration via preserving mitochondrial antioxidant capacity. PMID:25541039
  13. Lysine glutarylation is a protein posttranslational modification regulated by SIRT5. PMID:24703693
  14. Loss of SIRT5 leads to accumulation of medium- and long-chain acylcarnitines and decreased beta-hydroxybutyrate production in vivo. PMID:24315375
  15. Sirt5 is likely to be dispensable for the metabolic homeostasis under the basal conditions. PMID:24076663
  16. We have isolated and characterized the murine sirt5 genomic sequence, which spans a region of 24,449 bp and which has one single genomic locus. PMID:23673559
  17. SIRT5 represses biochemical activity of, and cellular respiration through, two protein complexes identified as pyruvate dehydrogenase complex and succinate dehydrogenase. PMID:23806337
  18. The results suggest that SIRT5 activates UOX through deacetylation in mouse liver mitochondria. PMID:23085393
  19. These data indicate SIRT5 also has a role in the metabolic adaptation to fasting, high protein diet and calorie restriction. PMID:20157539
  20. Because ammonia generated during fasting is toxic, SIRT5 protein might play a protective role by converting ammonia to non-toxic urea through deacetylation and activation of CPS1. PMID:20097174
  21. results suggest that the SIRT3, SIRT4, and SIRT5 proteins exert distinct functions in mitochondria. PMID:18054327
  22. SIRT5 plays a pivotal role in ammonia detoxification and disposal by activating carbamoyl phosphate synthetase 1 PMID:19410549

Show More

Hide All

Subcellular Location
Mitochondrion. Cytoplasm, cytosol. Nucleus. Note=Mainly mitochondrial. Also present extramitochondrially, with a fraction present in the cytosol and very small amounts also detected in the nucleus.
Protein Families
Sirtuin family, Class III subfamily
Tissue Specificity
Detected in brain, liver, heart, kidney, lung, thymus, spleen, skeletal muscle, intestine, pancreas and testis (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products