Abbreviation
Recombinant Mouse Kit protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg(CSB-MP012376MO1) at 2 μg/mL can bind Mouse Kit.The EC50 is 15.57-20.95 ng/mL.
Alternative Names
Mast/stem cell growth factor receptor Kit; EC:2.7.10.1; SCFR;Proto-oncogene c-Kit; Tyrosine-protein kinase Kit; CD117; Kit; Sl
Species
Mus musculus (Mouse)
Expression Region
25-519aa
Target Protein Sequence
SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKEQIQAHT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial of Isoform 2
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg(CSB-MP012376MO1) at 2 μg/ml can bind Mouse Kit.The EC50 is 15.57-20.95 ng/mL.
-
The purity of Kit was greater than 90% as determined by SEC-HPLC
Description
Kit receptor signaling drives proliferation and survival in hematopoietic stem cells and mast cell lineages, making it a central target in leukemia and gastrointestinal stromal tumor research. This mammalian-expressed construct spans residues 25–519 of isoform 2, capturing the extracellular ligand-binding domain in a conformation that binds immobilized mouse stem cell factor with an EC50 of 15.57–20.95 ng/mL in functional ELISA, providing quantitative evidence of native receptor-ligand interaction. The measured affinity supports use in competitive inhibition assays to screen blocking antibodies, in epitope mapping studies for therapeutic antibody development, and as a positive control in SPR or BLI experiments characterizing Kit-targeted biologics. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in cell-based assays and in vitro kinase inhibitor screening platforms.
