Abbreviation
Recombinant Mouse Kit protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit at 2 μg/mL can bind Mouse Kitlg (CSB-MP012376MO1d9). The EC50 is 19.35-24.80 ng/mL. ②Mouse Kitlg (CSB-MP012376MO1d9) captured on Protein A Chip can bind Recombinant Mouse Kit with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
Mast/stem cell growth factor receptor Kit; SCFR; EC 2.7.10.1; Proto-oncogene c-Kit; Tyrosine-protein kinase Kit; CD antigen CD117
Species
Mus musculus (Mouse)
Expression Region
25-523aa
Target Protein Sequence
SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKEQIQAHTLFTP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial of Isoform 2
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit at 2 μg/ml can bind Mouse Kitlg (CSB-MP012376MO1d9). The EC50 is 19.35-24.80 ng/mL.
-
Activity
Mouse Kitlg (CSB-MP012376MO1d9) captured on Protein A Chip can bind Recombinant Mouse Kit with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200).
-
The purity of Kit was greater than 95% as determined by SEC-HPLC
Description
The extracellular domain of mouse Kit (aa 25–523) mediates stem cell factor binding and initiates signaling cascades central to hematopoiesis, melanogenesis, and mast cell development, making it a critical target in cancer biology and developmental research. Mammalian expression preserves native glycosylation and disulfide architecture, yielding a protein that binds mouse stem cell factor with an EC50 of 19.35–24.80 ng/mL in functional ELISA and demonstrates a 15.1 nM affinity constant by surface plasmon resonance, quantitative metrics that support its use in ligand-binding assays, competitive inhibition screens, and therapeutic antibody epitope mapping. This conformational integrity enables reliable screening of small-molecule or biologic inhibitors targeting the Kit receptor pathway, as well as validation of blocking antibodies in oncology-focused drug discovery programs. Purity exceeding 95% by both SDS-PAGE and SEC-HPLC, combined with endotoxin levels below 1.0 EU/μg, aligns with standards expected in quantitative binding studies and antibody development workflows.