Recombinant Mouse Fibroblast growth factor 9 (Fgf9)

Code: CSB-MP008638MO
Size:
20ug
20ug100ug1mg
US$190
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: N-terminal hFc1-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Fgf9 protein
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Fgf9
Uniprot NO.
Research Area
Immunology
Alternative Names
Glia-activating factor;HBGF-9
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
4-208aa
Target Protein Sequence
LGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
Gene References into Functions
  1. stage-specific expression of FGF9 in XY gonads regulates different signal transduction pathways, ERK1/2 and p38, in XY primordial germ cells, resulting in the balance between proliferation and differentiation of the cells PMID:28395336
  2. the localization of FGF9 and its receptors at different embryonic and postnatal stages in mice testes, was examined. PMID:27078042
  3. results suggested that the combination of nCS (to support bone formation) with a fibrin-based VEGF/FGF9 release system (support vascular formation) is an innovative and effective strategy that significantly enhanced ectopic bone formation in vivo. PMID:27269204
  4. FGF9 is a crucial factor required for establishing an appropriate microenvironment for successful implantation and for pregnancy establishment. Additional analyses of pathways through which FGF9 participates in angiogenesis and endometrium-embryo communication should contribute to the understanding of molecular mechanisms that underlay process of implantation. PMID:28848153
  5. we conclude that the S99N mutation in Fgf9 causes multiple synostoses syndrome (SYNS) via the disturbance of joint interzone formation. These results further implicate the crucial role of Fgf9 during embryonic joint development PMID:28169396
  6. Our results suggest that mature osteoblasts are an important source of FGF9, positively regulating skeletal homeostasis in male mice PMID:28189801
  7. suggests FGF-9 has the potential to attenuate vascular cell apoptosis, activate c-Kit progenitor cells, and enhance angiogenesis and neovascularization in C57BL/6 and db/db mice leading to improved cardiac function. PMID:26682010
  8. Sox11 directly regulates the expression of Fgf9; ablation of the Sox11 gene results in clefting of the secondary palate resembling the Pierre Robin sequence. PMID:26826126
  9. data demonstrated that overexpressing FGF9 in PCa cells augmented the formation of reactive stroma and promoted PCa initiation and progression PMID:26157349
  10. These studies identify FGF9 as a target of DICER1 in lung epithelium that functions as an initiating factor for pleuropulmonary blastoma. PMID:25978641
  11. FGF-9 possesses novel therapeutic potential in its ability to mediate monocyte to M2 differentiation and confer cardiac protection in the post-infarction diabetic heart. PMID:25768089
  12. Data show that Fibroblast Growth Factors (FGF) 9 and 20 regulate the number of cochlear progenitors. PMID:25915623
  13. cerebellar microexplant cultures treated with an FGFR agonist or antagonist, we also show that FGF9/FGFR-mediated signaling inhibits the outward migration of radial glia and Bergmann glia precursors and cells PMID:24983448
  14. our data demonstrate that FGF9 can initiate a complex astrocytic response predicted to compromise remyelination, while at the same time stimulating microglial/macrophage recruitment in multiple sclerosis lesions PMID:25907862
  15. Demonstrate the complex role of FGF9-FGFR3 signalling in the initiation, growth and propagation of lung cancer. PMID:25413587
  16. FGF9 overexpression in lung leads to adenocarcinoma. PMID:23867472
  17. Loss of Fgf9 in XX Wnt4-/- gonads does not rescue their partial female-to-male sex-reversal. PMID:22705479
  18. The data suggested that, at a minimum, Fgf9/20 and Bmp7 organize the nephron progenitor niche. FGF signaling likely regulates multiple important steps in the niche, including survival, proliferation, and competence. PMID:22698282
  19. TGFbeta-FGF9-PITX2 signaling cascade regulates cranial neural crest cell proliferation during palate formation. PMID:22123828
  20. Data point to a role of Fgf9 signalling in primary and secondary lens fiber cell growth. PMID:21858205
  21. Data demonstrate that mesothelial- and epithelial-derived FGF9, mesenchymal Wnt2a and epithelial Wnt7b have unique functions in lung development in mouse. PMID:21750028
  22. Conditional expression of FGF9 promotes myocardial vascularization and hypertrophy with enhanced systolic function and reduced heart failure mortality after MI PMID:21262993
  23. Results suggest collectively that Fgf9 signalling from the outer mesothelial lining induce Spred/Sprouty expression in the underlying pancreatic mesenchyme. PMID:20934536
  24. Fgf9 stimulates steroidogenesis in postnatal Leydig cells. PMID:19508331
  25. data suggest a unique role for Fgf-9 in bone healing, presumably by initiating angiogenesis through Vegf-a PMID:20547837
  26. Data demonstrate that FGF9 can act as a diffusible conductor for a poleward expansion of tubulogenic programs at early phases of testis differentiation. PMID:20040496
  27. Recombinant fgf9 protein inhibits the differentiation response of the mesoderm to Shh, but does not affect proliferation. PMID:12781691
  28. Data show that Fgf9 is necessary for testis development, playing a role in the proliferation of cells that give rise to Sertoli progenitors and in the nuclear localization of FGF receptor R2 in Sertoli cell precursors. PMID:15229180
  29. To address the role of Fgf9 signaling, we analyzed the inner ears of mice homozygous for Fgf9 null alleles. Fgf9 inactivation leads to a hypoplastic vestibular component of the otic capsule and to the absence of the epithelial semicircular ducts. PMID:15328018
  30. FGF9 plays an important role in proliferation and organisation of embryonic Sertoli cells during testis morphogenesis PMID:15470636
  31. An epithelial FGF9 signal is necessary for the expansion of cecal mesenchyme and the expression of mesenchymal genes that are required for epithelial budding. PMID:16308329
  32. FGF9 acts on the lung mesenchyme to induce proliferation and decrease differentiation PMID:16494859
  33. FGF9 is necessary for 11.5 days post coitum fetal XY gonocyte survival and is the earliest reported factor with a sex-specific role in regulating germ cell survival. PMID:16540514
  34. the Sprouty proteins are involved normally in mediating the sexually dimorphic signaling of FGF9 and controlling cell migration from the mesonephros during testis development PMID:16675530
  35. The fate of the gonad is controlled by antagonism between Fgf9 and Wnt4. PMID:16700629
  36. Although Fgf9 is expressed in the apical ectodermal ridge in the limb bud, we demonstrate that the Fgf9-/- limb phenotype results from loss of FGF9 functions after formation of the mesenchymal condensation. PMID:17544391
  37. These data suggest a molecular mechanism through which FGF9 and sonic hedgehog signaling coordinately control the growth and patterning of the lung capillary plexus, and regulate the temporal and spatial expression of Vegfa. PMID:17881491
  38. The interaction of FGF and TGFbeta signaling pathways in the intestinal mesenchyme could represent novel targets for future short bowel syndrome therapies. PMID:18653563
  39. Results show that loss of fibroblast growth factor 9 or conditional inactivation of Fgf receptors (Fgfr) 1 and 2 in mouse lung mesenchyme results in ectopic airway smooth muscle cells. PMID:19097117
  40. A mechanism in which the range of FGF9 signaling in developing tissues is limited by its ability to homodimerize and its affinity for extracellular matrix heparan sulfate proteoglycans. PMID:19219044
  41. Neuron-derived Fgf9 is essential for scaffold formation of Bergmann radial fibers and migration of granule neurons in the cerebellum. PMID:19232523
  42. the PGD2 signaling pathway is likely to act independently of FGF9, thus implicating two independent feedforward loops between Sox9/Fgf9 and Sox9/L-Pgds in the coordination of growth, cell differentiation and morphogenesis of the gonad. PMID:19429785

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links

UNIGENE: Mm.8846

KEGG: mmu:14180

STRING: 10090.ENSMUSP00000022545

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products