Home
Product
Protein
Recombinant Proteins
Recombinant Mouse C-X-C motif chemokine 14 (Cxcl14)

Recombinant Mouse C-X-C motif chemokine 14 (Cxcl14)

Code: CSB-RP093194m

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$306

Quantity:

Express system: E.coli

Species: Mus musculus (Mouse)

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Cxcl14

Uniprot NO.

Q9WUQ5

Research Area

Others

Alternative Names

B-cell and monocyte-activating chemokineChemokine BRAKKidney-expressed chemokine CXCMIP-2GSmall-inducible cytokine B14

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

23-99aa

Target Protein Sequence

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells.

Gene References into Functions

Platelets are a relevant source of CXCL14. Platelet-derived CXCL14 at the site of vascular lesions might play an important role in vascular repair/regeneration. PMID:28359053
CXCL14 Tg mice showed a suppressed rate of carcinogenesis, decreased tumour volume, and reduced pulmonary metastasis, as well as an increased survival rate of mice following tumour cell injection. PMID:25765541
CXCL14 does not seem to play a pivotal role during influenza and Escherichia coli infections of the lung. PMID:25313607
CXCL14 was able to promote bone metastasis through enhancement of cancer cell tropism to the bone and/or recruitment of bone marrow cells around metastatic cancer cells. PMID:24534874
In conclusion, our results suggested the important function of Cxcl14 in uNK cells and the proper level of Cxcl14 protein were required to recruit NK cells to pregnant uterus. PMID:23688424
the transient expression of CXCL14 by Purkinje cells in the developing cerebellum, suggesting that it must be involved in the postnatal maturation of the cerebellum PMID:22843118
CXCL14 may play an important role in central nervous system regulation of feeding behavior PMID:20428232
Study identifies CXCL14 as a novel marker of tendon connective tissue. PMID:21038449
Murine CXCL14 is dispensable for the homeostatic recruitment of antigen-presenting cells toward the periphery and for LC functionality. PMID:17130243
CXCL14 is a critical chemoattractant of white adipose tissue macrophages and a novel regulator of glucose metabolism that functions mainly in skeletal muscle. PMID:17724031
These results suggest that CXCL14 plays a causal role in high-fat diet-induced obesity. PMID:17971304
Data suggest that despite the structural homology and similarity in tissue distribution of human and murine CXCL14, distinct differences point to diverse, species-specific needs for CXCL14 in epithelial immunity. PMID:18809336
findings demonstrate that early overexpression of PMP22 in a mouse model of Charcot-Marie-Tooth disease type 1A results in a strong up-regulation of CXCL14 which seems to play a novel regulatory role in Schwann cell differentiation PMID:19111616
CXCL14 is an important paracrine/autocrine modulator regulating trophoblast outgrowth at the maternal-fetal interface during the process of pregnancy establishment. PMID:19626669
These data indicate the possibility that BRAK expression inhibits tumor cell establishment by regulating interactions between tumor stem cells and NK cells and/or suppressing formation of tumor microvessels. PMID:19887729