Abbreviation
Recombinant Rhesus macaque TNFSF15 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta TNFSF15 at 2 μg/mL can bind Anti-HSPA5 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.9216-1.128 ng/mL.
Alternative Names
Tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor
Species
Macaca mulatta (Rhesus macaque)
Expression Region
72-251aa
Target Protein Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta TNFSF15 at 2 μg/ml can bind Anti-HSPA5 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.9216-1.128 ng/mL.
Description
TNFSF15 plays a critical role in vascular remodeling and immune regulation, making it a key target in cancer biology and inflammatory disease research. This rhesus macaque ortholog, spanning residues 72–251, demonstrates robust receptor-binding activity with an EC50 of 0.92–1.13 ng/mL in functional ELISA, confirming that the recombinant protein retains native signaling competence suitable for cell-based activation and apoptosis assays in primate-derived cell lines. The low endotoxin level (< 1.0 EU/μg) meets the quality thresholds commonly required for immune cell functional studies, where LPS contamination would confound readouts in NF-κB and MAPK pathway analyses. Purity exceeding 95% by SDS-PAGE, combined with the quantified binding potency, supports use of this protein as a coating antigen in antibody development workflows and as a positive control in cytokine detection platforms targeting the TNF superfamily.
