Abbreviation
Recombinant Cynomolgus monkey TSLP protein, Biotinylated (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/mL on streptavidin coated plates can bind Macaca fascicularis CRLF2 protein(CSB-MP5357MOV). The EC50 is 2.698-3.710 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/mL on streptavidin coated plates can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 11.71-21.61 ng/mL.
Alternative Names
Thymic stromal lymphopoietin; TSLP
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
29-159aa
Target Protein Sequence
YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/ml on streptavidin coated plates can bind Macaca fascicularis CRLF2 protein(CSB-MP5357MOV). The EC50 is 2.698-3.710 ng/mL.
-
Activity
②Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/ml on streptavidin coated plates can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 11.71-21.61 ng/mL.
Description
TSLP initiates type 2 immune responses by engaging a heterodimeric receptor complex, making quantitative assessment of receptor binding essential for modeling allergic inflammation and epithelial–immune crosstalk. This biotinylated cynomolgus macaque TSLP, spanning the full mature sequence (aa 29–159), demonstrates robust binding to its cognate receptor CRLF2 with an EC50 of 2.698–3.710 ng/mL in functional ELISA, providing a quantitative benchmark for cell-based activation assays using primary dendritic cells or PBMC to study Th2 polarization and cytokine secretion profiles. The protein also binds an anti-TSLP monoclonal antibody with an EC50 of 11.71–21.61 ng/mL, supporting its use as a coating antigen in antibody development workflows and as a positive control in ELISA or Western blot validation of TSLP detection reagents. With endotoxin levels below 1.0 EU/μg and purity exceeding 90%, this preparation meets the quality thresholds commonly required for immune cell functional assays where LPS contamination would confound interpretation of TSLP-driven signaling through JAK/STAT pathways.
