Abbreviation
Recombinant Cynomolgus monkey TSLP protein (R127A,R130S) (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Loaded Cynomolgus TSLP(R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody(CSB-RA025141MA1HU), with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime).
②Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(R127A,R130S) at 2 μg/mL can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 45.77-53.37 ng/mL.
Alternative Names
Thymic stromal lymphopoietin; TSLP
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
29-159aa(R127A,R130S)
Target Protein Sequence
YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Loaded Cynomolgus TSLP(R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody(CSB-RA025141MA1HU), with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime).
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP(R127A,R130S) at 2 μg/ml can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 45.77-53.37 ng/mL.
Description
TSLP drives type 2 immune responses by activating dendritic cells and promoting Th2 differentiation, making it a central mediator in allergic inflammation and asthma pathogenesis. This cynomolgus variant carries R127A and R130S substitutions and spans the full mature sequence (aa 29–159), enabling direct comparison with wild-type TSLP in structure-function studies and therapeutic antibody screening. Functional ELISA demonstrates antibody binding with an EC50 of 45.77–53.37 ng/mL, while biolayer interferometry confirms high-affinity interaction (KD = 4.41 nM), supporting use in antibody development workflows including epitope mapping, candidate ranking, and neutralization assays. The protein meets the purity and endotoxin criteria typical for cell-based assays (>95% pure, <1.0 EU/μg), providing a suitable basis for PBMC activation studies, dendritic cell maturation experiments, and JAK/STAT signaling pathway analysis where endotoxin contamination would confound cytokine-specific responses.
-SDS.jpg)
-AC1.jpg)
-AC2.jpg)
