Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx (vpx)

CSB-EP325553HLU
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
vpx
Uniprot NO.
Research Area
Others
Alternative Names
Viral protein XX ORF protein
Species
Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2)
Source
E.coli
Expression Region
1-113aa
Target Protein Sequence
MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV
Mol. Weight
17.2kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP325553HLU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) vpx.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP325553HLU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) vpx.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
Gene References into Functions
  1. These results indicate that Vpx, in addition to SAMHD1, overcomes a previously unappreciated restriction for lentiviruses at the level of reverse transcription (RT)that acts independently of dNTP concentrations and is specific to resting CD4 T cells. PMID:28228523
  2. zinc binding appears to mitigate flexibility of the three-helix fold of Vpx, thereby preventing dysfunction. PMID:28284276
  3. Data indicate that proline residue P109 within the C-terminal poly-proline motif (PPM) of Vpx protein plays a unique role in the regulation of SAM domain and HD domain 1 protein SAMHD1 degradation. PMID:25936766
  4. HIV-2 Vpr can trigger G2 cell cycle arrest through either CUL4A or CUL4B. PMID:24719410
  5. Vpx expression results in decreased promoter binding activity of IRF5 PMID:24532789
  6. Poly-proline motif in Vpx is critical for its efficient expression in cells. PMID:24114794
  7. Data suggest that, in an evolutionary model of virus-host interactions, binding of Vpx/Vpr with SAMHD1 (and subsequent degradation of SAMHD1 [SAM domain/HD domain-containing protein 1]) exhibits dynamic requirements that have toggled back and forth. PMID:23874202
  8. the crystal structure of a ternary complex of Vpx with the human E3 ligase substrate adaptor DCAF1 and the carboxy-terminal region of human SAMHD1 PMID:24336198
  9. direct down-modulation of Vpx catalytic activity, mediated by the same binding event that leads to SAMHD1 recruitment to the E3 ubiquitin ligase for proteasome-dependent degradation PMID:23677995
  10. Effective immune control of viral replication in HIV-2-infected individuals is not associated with increased Vpx-mediated degradation of SAMHD1. PMID:23497283
  11. there are several Vpx residues required for SAMHD1 degradation PMID:23076149
  12. The Vpx lentiviral accessory protein targets human SAMHD1 for degradation in the nucleus. PMID:22973040
  13. Vpx targets SAMHD1 for degradation in a viral strategy to control cellular deoxynucleotide levels for efficient replication PMID:22069334
  14. structure and cytopathogenic activity PMID:16153874
  15. These studies map critical residues of the Vpx nuclear localization signal that are required for efficient infection of non-dividing cells. PMID:16325220
  16. We found that insertion within the polyproline-containing C-terminus destabilizes nuclear localization, whereas mutating a second helix in the central domain disrupts viral packaging. PMID:16457868
  17. results indicated that Vpx and Vpr of HIV-2 may cooperatively contribute to virion infectivity without affecting virion morphogenesis PMID:16953064
  18. The results here clearly demonstrated that the entire Vpx protein is critical for reverse transcription of the HIV-2 genome in human monocyte-derived macrophages. PMID:18495778
  19. when transferred in the context of a replication-competent viral clone, Vpx was required for replication in dendritic cells PMID:18829761
  20. Vpx diverts the Cul4A-DDB1(DCAF1) ligase to inactivate an evolutionarily conserved factor, which restricts macrophage infection by HIV-2. PMID:19264781

Show More

Hide All

Subcellular Location
Virion. Host nucleus.
Protein Families
Lentivirus VPX protein family
Database Links

KEGG: vg:1724714

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products