Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A)

In Stock
Code: CSB-EP517245HWWe1
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$472
Quantity:
Express system: E.coli
Species: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
UL111A
Uniprot NO.
Research Area
others
Alternative Names
UL111A; Viral interleukin-10 homolog; cmvIL-10; vIL-10
Species
Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Source
E.coli
Expression Region
26-176aa
Target Protein Sequence
ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP517245HWWE1 could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) UL111A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP517245HWWE1 could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) UL111A.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.
Gene References into Functions
  1. Authors show that the previously observed downregulation of hsa-miR-92a and upregulation of CCL8 during human cytomegalovirus latent infection of myeloid cells are intimately linked via the latency-associated expression of cytomegalovirus UL111A. PMID:25253336
  2. These results suggest a significant and wide-ranging role for cmvIL-10 in the progression of breast cancer. PMID:24520416
  3. cIL-10 expressing CD4 T-cells are directed against latently expressed US28 and UL111A. PMID:24130479
  4. This study identifies a novel role for viral IL-10 in driving M2c polarization, which may limit virus clearance by restricting proinflammatory and CD4(+) T cell responses at sites of infection. PMID:23864618
  5. CmvIL-10 bound avidly to the same receptors on blood mononuclear cells and was as bio-potent as native human IL-10. PMID:21402594

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-10 family
Database Links

KEGG: vg:3077506

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products