Abbreviation
Recombinant Human TNFRSF4 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF4 at 2 μg/mL can bind Anti-TNFRSF4 recombinant antibody (CSB-RA023981MA1HU). The EC50 is 4.882-5.863 ng/mL.
Alternative Names
Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Species
Homo sapiens (Human)
Expression Region
29-216aa
Target Protein Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF4 at 2 μg/ml can bind Anti-TNFRSF4 recombinant antibody (CSB-RA023981MA1HU). The EC50 is 4.882-5.863 ng/mL.
Description
TNFRSF4 (OX40) functions as a costimulatory receptor on activated T cells, making it a target of interest in cancer immunotherapy for enhancing antitumor immune responses. This mammalian-expressed construct spanning residues 29–216 captures the complete extracellular ligand-binding domain and demonstrates quantified binding activity with an EC50 of 4.882–5.863 ng/mL against an anti-TNFRSF4 antibody in functional ELISA, providing a validated basis for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody development. The confirmed receptor-antibody interaction supports its use as a positive control in ligand-binding assays and enables affinity characterization by surface plasmon resonance or biolayer interferometry when evaluating OX40-targeted biologics. Mammalian expression preserves native glycosylation and disulfide bonding critical for proper folding of this TNFR superfamily member, while purity exceeding 90% and endotoxin levels below 1.0 EU/μg satisfy the quality criteria typical for quantitative binding studies and small-molecule inhibitor screening in immune checkpoint research.