Abbreviation
Recombinant Human TNFRSF4 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse OX40L-His at 10μg/ml can bind Human OX40-6His (Biotinylated by NHS-biotin prior to testing), the ED50 of Recombinant Human OX40-6His is 1.44 ug/ml.
Alternative Names
TNFRSF4; TXGP1L; Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Species
Homo sapiens (Human)
Expression Region
29-216aa
Target Protein Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
OX40 (TNFRSF4/CD134) is a costimulatory immune checkpoint receptor critical to T-cell survival and memory formation, making it a high-priority target in immuno-oncology drug development. This recombinant human OX40 construct covers the extracellular ligand-binding domain (residues 29–216) and is expressed in mammalian cells to preserve native disulfide bonding and glycosylation essential for proper receptor folding. Functional ELISA confirms ligand-binding competence, with an ED50 of 1.44 µg/mL against immobilized OX40L, supporting use in receptor-ligand interaction assays, competitive blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. The C-terminal 6×His tag facilitates oriented immobilization, while purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/µg satisfy the quality thresholds commonly required for sensitive binding assays and immune checkpoint research in cancer biology.