Abbreviation
Recombinant Human LTBR protein, partial (Active)
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Anti-LTBR recombinant antibody (CSB-RA013227MA1HU), the EC50 is 0.5282-0.6120 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 7.283-8.859 ng/ml.
Alternative Names
CD18; D12S370; LT beta R; LTBETAR; Ltbr; Lymphotoxin B receptor; Lymphotoxin beta receptor (TNFR superfamily; member 3); Lymphotoxin beta receptor; Lymphotoxin-beta receptor; TNF R III; TNF-RIII; TNFCR; TNFR RP; TNFR superfamily member 3; TNFR-III; TNFR2 RP; TNFR2RP; TNFR3; TNFRII; TNFRRP; TNFRSF 3; TNFRSF3; TNR3_HUMAN; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2 related protein; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; Tumor necrosis factor receptor superfamily member 3 precursor; Tumor necrosis factor receptor type III
Species
Homo sapiens (Human)
Expression Region
31-227aa
Target Protein Sequence
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind Anti-LTBR recombinant antibody (CSB-RA013227MA1HU), the EC50 is 0.5282-0.6120 ng/mL.
-
Activity
②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 7.283-8.859 ng/ml.
Description
Lymphotoxin-beta receptor plays a central role in lymphoid organogenesis and immune homeostasis, making its extracellular domain (aa 31–227) a critical tool for dissecting TNF superfamily signaling networks. This yeast-expressed construct demonstrates robust binding to both a recombinant anti-LTBR antibody (EC50 0.53–0.61 ng/mL) and its natural ligand TNFSF14/LIGHT (EC50 7.3–8.9 ng/mL) in functional ELISA, providing quantitative evidence of preserved conformational epitopes suitable for competitive inhibition assays and therapeutic antibody epitope mapping. The low endotoxin level (<1.0 EU/μg) combined with >95% purity supports use in ligand-binding screens where inflammatory background must be minimized, including SPR-based affinity characterization and blocking antibody validation campaigns. Researchers investigating TNF receptor superfamily crosstalk or developing biologics targeting LTBR-mediated pathways will find the dual-validated binding activity particularly valuable for establishing dose-response curves in drug discovery workflows.
