Abbreviation
Recombinant Human TNFRSF10B protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF10 (CSB-EP023985HU1a0) at 4 μg/mL can bind Human TNFRSF10B. The EC50 is 3.897-5.215 ng/mL.
Alternative Names
Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2; TRAIL receptor 2; TRAIL-R2; CD antigen CD262
Species
Homo sapiens (Human)
Expression Region
56-182aa
Target Protein Sequence
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF10 (CSB-EP023985HU1a0) at 4 μg/ml can bind Human TNFRSF10B. The EC50 is 3.897-5.215 ng/mL.
Description
Death receptor 5 mediates TRAIL-induced apoptosis in tumor cells while sparing most normal tissues, making it a critical target for selective cancer therapeutics. This recombinant extracellular domain (aa 56–182) demonstrates quantified ligand-binding activity with an EC50 of 3.897–5.215 ng/mL when paired with immobilized TRAIL, providing a validated reagent for competitive inhibition assays, therapeutic antibody epitope mapping, and small-molecule inhibitor screening in drug discovery campaigns. Mammalian expression preserves the native glycosylation and disulfide architecture essential for physiological receptor conformation, supporting accurate affinity characterization by surface plasmon resonance or biolayer interferometry. With purity exceeding 90% and endotoxin below 1.0 EU/μg, this protein meets the quality thresholds commonly required for functional ELISA platforms and blocking antibody validation studies in cancer immunotherapy research.